GapMind for catabolism of small carbon sources

 

Aligments for a candidate for odc in Klebsiella michiganensis M5al

Align ornithine decarboxylase (EC 4.1.1.17) (characterized)
to candidate BWI76_RS05300 BWI76_RS05300 lysine decarboxylase LdcC

Query= BRENDA::Q5ZH57
         (745 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS05300 BWI76_RS05300 lysine
           decarboxylase LdcC
          Length = 712

 Score =  331 bits (849), Expect = 7e-95
 Identities = 221/689 (32%), Positives = 350/689 (50%), Gaps = 47/689 (6%)

Query: 45  ADNSDFVD----VAAVVVMDDEKAIINKADETKFN--IPIFIITDDSSKVDGETMSKIFH 98
           AD   F++    +  V+   DE ++   +D  + N  +P++   +  S +D    S+   
Sbjct: 40  ADLLQFIEHNPRICGVIFDWDEYSVDLCSDINRLNEYLPLYAFINAHSTMD--VSSQDLR 97

Query: 99  IIDWHNNYDRRLYDR---EIEAAAKKYEDGVLPPFFKALKAYVERGNIQFDCPGHQGGQY 155
           +  W   Y   L +     I    ++Y D + PPF KAL  YV+ G   F  PGH GG  
Sbjct: 98  MTLWFFEYALGLAEEIATRIGQYTREYLDNITPPFTKALFNYVQEGKYTFCTPGHMGGSA 157

Query: 156 FRKSPAGREFYNFYGENIFRSDICNADVDLGDLLIHEGPAMDAEKHAARVFNADKTYFVM 215
           ++KSP G  FY+F+G N  ++D+  +  +LG LL H GP ++AE++ AR F A+++Y V 
Sbjct: 158 YQKSPVGCLFYDFFGGNTLKADVSISVTELGSLLDHSGPHLEAEEYIARAFGAEQSYMVT 217

Query: 216 NGTTTSNNIAITAAVAPGDLVLFDRNNHKSVYNAALVQAGGRPVYLETSRDSYGFIGGIY 275
           NGT+TSN I    +   G  +L DRN HKS+ +  L+ +   P++L+ +R++ G +GGI 
Sbjct: 218 NGTSTSNKIVGMYSAPAGSTLLIDRNCHKSLAH-LLMMSDVVPLWLKPTRNALGILGGIP 276

Query: 276 SKDFDEKSIREKIAKVDPEKAKAKRPFRLAVIQLGTYDGTIYNAKQVVERIGHLCDYILF 335
            ++F   SI++K+         A  P   AVI   TYDG +YN   + E +      I F
Sbjct: 277 KREFTRDSIQQKVNTT----GGAGWPVH-AVITNSTYDGLLYNTTWIKETLD--VPSIHF 329

Query: 336 DSAWVGYEQFIPMMKDSSPLLLNLGPDDPG--ILVTQSTHKQQAGFSQASQIHKKDSHIK 393
           DSAWV Y  F P+ +  S +    G   PG  I  TQSTHK  A  SQAS IH K S+  
Sbjct: 330 DSAWVPYTHFHPIYQGKSGM---SGDRIPGKVIFETQSTHKMLAALSQASLIHIKGSY-- 384

Query: 394 GQKRYINHKQFNNAYMKFSSTSPFYPLFATLDINAKMQEGEAGKKLWHDALVTSVNARKN 453
                 +   FN A+M  +STSP YP+ A+++  A M  G +G++L   ++  +++ RK 
Sbjct: 385 ------DEDTFNEAFMMHTSTSPSYPIVASIETAAAMLRGNSGRRLIQRSIERALDFRKE 438

Query: 454 LLKNATMIKPFLPPVVHGKPWQDADTEKIVSDIDYWKFEKGAKWHGFDGYADNQYFVDPN 513
           + +       +   +     WQ  +    V +   W    G +WHGF    D+  F+DP 
Sbjct: 439 VQRLREESDGWFFDI-----WQPEE----VGEAQCWPVSPGEQWHGFQDADDDHMFLDPV 489

Query: 514 KFMLTTPGIDVETGEYEDFGIPAVILANYLREHGIIPEKNDLNSILFLMTPAETQAKMDN 573
           K  + TPG+D E G  +  GIPA ++A +L E G++ EK    ++LFL +    + +   
Sbjct: 490 KVTILTPGMD-EQGNMDSEGIPAALVAKFLDERGVVVEKTGPYNLLFLFSIGIDKTRAMG 548

Query: 574 LVTQIVKFESLVKADAPLDEVLPRLYSEHQDRYEGYTIKQLCQEVHDFYKNNNTKEYQKE 633
           L+  + +F+     +  +  +LP LY+E  D Y    I+ L Q +H   + +   +    
Sbjct: 549 LLRGLTEFKRSYDLNLRVKNMLPDLYAEDPDFYRNMRIQDLAQGIHRLIRQHQLSQLMLS 608

Query: 634 MFLGKYFPEQAMTPYQANVELLKNNAKLVPLTDIEGLAALEGALPYPPGIFCIVPGEKWT 693
            F     PE  MTP+QA    +K   + + L ++ G  +    LPYPPG+  ++PGE   
Sbjct: 609 AF--DVLPEMKMTPHQAWQRQIKGEVETIELENLVGRISANMILPYPPGVPLLMPGEMIV 666

Query: 694 KVAQKY--FLILEESINR-FPGFAPEIQG 719
           + ++    FL++  SI R +PGF  +I G
Sbjct: 667 EESRAVLNFLLMLCSIGRHYPGFETDIHG 695


Lambda     K      H
   0.318    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1225
Number of extensions: 63
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 745
Length of database: 712
Length adjustment: 40
Effective length of query: 705
Effective length of database: 672
Effective search space:   473760
Effective search space used:   473760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory