GapMind for catabolism of small carbon sources

 

Aligments for a candidate for odc in Klebsiella michiganensis M5al

Align ornithine decarboxylase (EC 4.1.1.17) (characterized)
to candidate BWI76_RS07195 BWI76_RS07195 lysine decarboxylase CadA

Query= BRENDA::Q5ZH57
         (745 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS07195 BWI76_RS07195 lysine
           decarboxylase CadA
          Length = 715

 Score =  335 bits (860), Expect = 4e-96
 Identities = 211/620 (34%), Positives = 321/620 (51%), Gaps = 32/620 (5%)

Query: 114 EIEAAAKKYEDGVLPPFFKALKAYVERGNIQFDCPGHQGGQYFRKSPAGREFYNFYGENI 173
           +I+    +Y D +LPP  KAL  YV  G   F  PGH GG  F+KSP G  FY+F+G N 
Sbjct: 116 KIKQNTDEYIDTILPPLTKALFKYVREGKYTFCTPGHMGGTAFQKSPVGSIFYDFFGSNT 175

Query: 174 FRSDICNADVDLGDLLIHEGPAMDAEKHAARVFNADKTYFVMNGTTTSNNIAITAAVAPG 233
            +SDI  +  +LG LL H GP  +AE++ ARVFNA+++Y V NGT+T+N I    +   G
Sbjct: 176 MKSDISISVSELGSLLDHSGPHKEAEEYIARVFNAERSYMVTNGTSTANKIVGMYSAPAG 235

Query: 234 DLVLFDRNNHKSVYNAALVQAGGRPVYLETSRDSYGFIGGIYSKDFDEKSIREKIAKVDP 293
             VL DRN HKS+ +  ++ +   P+Y   +R++YG +GGI   +F   +I +++     
Sbjct: 236 STVLIDRNCHKSLTH-LMMMSDITPIYFRPTRNAYGILGGIPQSEFQHATIAKRV----K 290

Query: 294 EKAKAKRPFRLAVIQLGTYDGTIYNAKQVVERIGHLCDYILFDSAWVGYEQFIPMMKDSS 353
           E   A  P   AVI   TYDG +YN   + + +      I FDSAWV Y  F P+ +   
Sbjct: 291 ETPNATWPVH-AVITNSTYDGLLYNTDYIKKTLD--VKSIHFDSAWVPYTNFSPIYEGKC 347

Query: 354 PLLLNLGPDDPGILVTQSTHKQQAGFSQASQIHKKDSHIKGQKRYINHKQFNNAYMKFSS 413
             +     +   I  TQSTHK  A FSQAS I     H+KG    +N + FN AYM  ++
Sbjct: 348 G-MSGGRVEGKVIYETQSTHKLLAAFSQASMI-----HVKGD---VNEETFNEAYMMHTT 398

Query: 414 TSPFYPLFATLDINAKMQEGEAGKKLWHDALVTSVNARKNLLKNATMIKPFLPPVVHGKP 473
           TSP Y + A+ +  A M +G AGK+L   ++  S+  RK + +       +   V     
Sbjct: 399 TSPHYGVVASTETAAAMMKGNAGKRLIDGSIERSIKFRKEIKRLKGESDGWFFDV----- 453

Query: 474 WQDADTEKIVSDIDYWKFEKGAKWHGFDGYADNQYFVDPNKFMLTTPGIDVETGEYEDFG 533
           WQ     + +   + W     + WHGF    +   ++DP K  L TPG+  + G  +DFG
Sbjct: 454 WQ----PEHIDGAECWPLRSDSAWHGFKNIDNEHMYLDPIKVTLLTPGMK-KDGTMDDFG 508

Query: 534 IPAVILANYLREHGIIPEKNDLNSILFLMTPAETQAKMDNLVTQIVKFESLVKADAPLDE 593
           IPA I+A YL EHGI+ EK    ++LFL +    + K  +L+  +  F+     +  +  
Sbjct: 509 IPASIVAKYLDEHGIVVEKTGPYNLLFLFSIGIDKTKALSLLRALTDFKRAFDLNLRVKN 568

Query: 594 VLPRLYSEHQDRYEGYTIKQLCQEVHDFYKNNNTKEYQKEMFLGKYFPEQAMTPYQANVE 653
           +LP LY E  + YE   +++L Q +H   +++N  +     F  +  P   +TPY A  +
Sbjct: 569 MLPSLYREDPEFYENMRVQELAQNIHKLIEHHNLPDLMFRAF--EVLPTMMITPYAAFQK 626

Query: 654 LLKNNAKLVPLTDIEGLAALEGALPYPPGIFCIVPGEKWTKVAQ---KYFLILEESINRF 710
            L    + V L ++ G       LPYPPG+  ++PGE  T+ ++   ++  +L E    +
Sbjct: 627 ELHGQTEEVYLEEMVGRVNANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGAHY 686

Query: 711 PGFAPEIQGVYFEKENGKSV 730
           PGF  +I G Y + +   +V
Sbjct: 687 PGFETDIHGAYRQADGRYTV 706


Lambda     K      H
   0.318    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1298
Number of extensions: 73
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 745
Length of database: 715
Length adjustment: 40
Effective length of query: 705
Effective length of database: 675
Effective search space:   475875
Effective search space used:   475875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory