GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patD in Klebsiella michiganensis M5al

Align Gamma-aminobutyraldehyde dehydrogenase; ABALDH; EC 1.2.1.19; 1-pyrroline dehydrogenase; 4-aminobutanal dehydrogenase; 5-aminopentanal dehydrogenase; EC 1.2.1.- (uncharacterized)
to candidate BWI76_RS03865 BWI76_RS03865 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase

Query= curated2:A8GHZ8
         (474 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS03865 BWI76_RS03865
           5-carboxymethyl-2-hydroxymuconate semialdehyde
           dehydrogenase
          Length = 488

 Score =  327 bits (837), Expect = 7e-94
 Identities = 187/474 (39%), Positives = 272/474 (57%), Gaps = 17/474 (3%)

Query: 7   INGQLVTGQGALLPVYNPATGEVVVQVAEASAEQVDQAVLAADAAFEHWGQTTPKERAEH 66
           ING+ V G        NPATGEV+ +VA   A++V+QAV AA  AF  W     KERA  
Sbjct: 8   INGKNVAGSD-YFHTTNPATGEVLAEVASGGADEVNQAVAAAKEAFPKWANLPMKERARL 66

Query: 67  LLKLADLIDSHAETFARLESINCGKPYHCVLNDELPGVADVFRFFAGASRCLSGLA--AG 124
           + +L DLID +    A +E+ + G P H   N  +P  +  F FFA   + ++G      
Sbjct: 67  MRRLGDLIDQNVPEIAAMETADTGLPIHQTKNVLIPRASHNFEFFAEVCQQMNGKTYPVD 126

Query: 125 EYLAGHTSMIRRDPLGVVASIAPWNYPLMMAAWKLAPALAAGNCVVLKPSEQTPLTTFKL 184
           + +  +T +    P+GV A ++PWN P M A WK+AP LA GN  VLK SE +PLT  +L
Sbjct: 127 DKMLNYTLV---QPVGVCALVSPWNVPFMTATWKVAPCLALGNTAVLKMSELSPLTADRL 183

Query: 185 AELA--AGLFPPGVLNVLFGRGASVGDRLTGHNKVRMVSLTGSIATGEHIIGHTASGIKR 242
            ELA  AG+ P GVLNV+ G GA+ GD L  H+ VR VS TG  ATG +I+ +  +G+K+
Sbjct: 184 GELALEAGI-PAGVLNVVQGYGATAGDALVRHHDVRAVSFTGGTATGRNIMKN--AGLKK 240

Query: 243 THMELGGKAPVLVFDDADLQQVVEGIRSFGFYNAGQDCTAACRIYAQKGIYPQLVKALGE 302
             MELGGK+PVL+F+DAD+++ ++      F   G+ CTA  RI+ Q+ IYP+ VK   E
Sbjct: 241 YSMELGGKSPVLIFEDADIERALDAALFTIFSINGERCTAGSRIFIQQSIYPEFVKRFAE 300

Query: 303 AIGSLKIGPPIDASSELGPLITAQHLERVVGFVERAKALPHVQVVTGGERVNG------P 356
               L++G P D ++++G LI+ QH E+V G++          +  G ++          
Sbjct: 301 RANRLRVGDPTDPNTQVGALISQQHWEKVSGYIRLGIEEGATLLAGGADKPTDLPAHLRN 360

Query: 357 GYYFQPTLLAGARQEDEIVQREVFGPVVTVTPFDDEAQVLAWANESDYGLASSLWTRDVG 416
           G + +PT+LA       + Q E+FGPV  + PF DEA+ L  AN+ +YGLAS +WT+DV 
Sbjct: 361 GNFLRPTVLADVDNRMRVAQEEIFGPVACLLPFKDEAEGLRLANDVEYGLASYIWTQDVS 420

Query: 417 RAHRLSARLQYGCTWVNTHFMLVSEMPHGGQKLSGYGKDMSMYGLEDYTAIRHV 470
           +  RL+  ++ G  +VNT  +     P GG K SG G++   Y  E +  +++V
Sbjct: 421 KVLRLARGIEAGMVFVNTQNVRDLRQPFGGVKASGTGREGGEYSFEVFAEMKNV 474


Lambda     K      H
   0.320    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 521
Number of extensions: 21
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 474
Length of database: 488
Length adjustment: 34
Effective length of query: 440
Effective length of database: 454
Effective search space:   199760
Effective search space used:   199760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory