GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patD in Klebsiella michiganensis M5al

Align 4-trimethylammoniobutyraldehyde dehydrogenase (EC 1.2.1.47) (characterized)
to candidate BWI76_RS07615 BWI76_RS07615 betaine-aldehyde dehydrogenase

Query= BRENDA::P49189
         (494 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS07615 BWI76_RS07615
           betaine-aldehyde dehydrogenase
          Length = 490

 Score =  483 bits (1243), Expect = e-141
 Identities = 248/475 (52%), Positives = 325/475 (68%), Gaps = 5/475 (1%)

Query: 23  ADASGTEKAFEPATGRVIATFTCSGEKEVNLAVQNAKAAFKIWSQKSGMERCRILLEAAR 82
           A +  T +   PA G V+AT   +G ++V+ AV++A+   KIW+  S MER RIL +A  
Sbjct: 18  ATSGKTFETINPANGEVLATVQAAGREDVDRAVKSAQKGQKIWAAMSAMERSRILRKAVD 77

Query: 83  IIREREDEIATMECINNGKSIFE-ARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGY 141
           I+R R DE+A +E ++ GK + E A +DI      LEYYAGL  ++ G  I L   SF Y
Sbjct: 78  ILRARNDELARLETLDTGKPLSETAAVDIVTGADVLEYYAGLIPALEGSQIPLRDSSFVY 137

Query: 142 TRREPLGVCVGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAGV 201
           TRREPLGV  GIGAWNYP QIA WKSAPALA GNAM+FKPS  TP++AL LAEIY EAG+
Sbjct: 138 TRREPLGVVAGIGAWNYPIQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEIYREAGL 197

Query: 202 PPGLFNVVQG-GAATGQFLCQHPDVAKVSFTGSVPTGMKIM-EMSAKGIKPVTLELGGKS 259
           P G+FNV+ G GA TGQ+L +HPD+AK+SFTG V +G K+M   +A  +K VT+ELGGKS
Sbjct: 198 PAGVFNVLPGTGAETGQYLTEHPDIAKISFTGGVASGKKVMANAAASSLKEVTMELGGKS 257

Query: 260 PLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEILDKFTEEVVKQTQRIKIGD 319
           PLI+  D  ++ A   A+MANF + GQVC NGTRVFV   +   F E+++ +  RI+ GD
Sbjct: 258 PLIVCEDASLDLAADIAMMANFYSSGQVCTNGTRVFVPTRLKAAFEEKILARVARIRPGD 317

Query: 320 PLLEDTRMGPLINRPHLERVLGFVKVAKEQGAKVLCGGDIYVPEDPKLKDGYYMRPCVLT 379
              E T  GPL++ PH + VL +++  K++GA++LCGG+    E      G ++ P V T
Sbjct: 318 LFAESTNFGPLVSFPHRDNVLRYIETGKQEGARLLCGGEALKGEG--FDRGAWVAPTVFT 375

Query: 380 NCRDDMTCVKEEIFGPVMSILSFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQ 439
           +C D MT V+EEIFGPVMSILS+D E E L RAN T +GLAAGV T D+ RAHR++  L+
Sbjct: 376 DCDDQMTIVREEIFGPVMSILSYDDEEEALRRANATEYGLAAGVVTPDLNRAHRLIHRLE 435

Query: 440 AGTCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF 494
           AG C+IN +  SP E+P GGYK SG GRENG  T+  Y+Q+K++ VEMG  +S F
Sbjct: 436 AGICWINTWGESPAEMPVGGYKHSGIGRENGVQTLHSYTQIKSIQVEMGQFQSIF 490


Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 664
Number of extensions: 31
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 494
Length of database: 490
Length adjustment: 34
Effective length of query: 460
Effective length of database: 456
Effective search space:   209760
Effective search space used:   209760
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory