GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocD in Klebsiella michiganensis M5al

Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate BWI76_RS24630 BWI76_RS24630 putrescine aminotransferase

Query= curated2:Q4A0N2
         (394 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS24630 BWI76_RS24630 putrescine
           aminotransferase
          Length = 468

 Score =  253 bits (647), Expect = 6e-72
 Identities = 151/418 (36%), Positives = 234/418 (55%), Gaps = 37/418 (8%)

Query: 1   MLDLYEHTDKYSSKNYSPLKLALAKG------RGAKVW---------DIEDNCYIDCISG 45
           M  L +   +Y  ++ +P  LA  K        GA  W         D +   +IDC+ G
Sbjct: 40  MKSLNQEVREYFKEHVNPGFLAYRKSVTAGGDYGAVEWQAGGLNTLVDTQGQEFIDCLGG 99

Query: 46  FSVVNQGHCHPKIIKALQEQSQRITMVSRALYSDNLGKWEEKICKLANKENVLPM--NTG 103
           F + N GH +P ++ A++ Q  +  + S+ L         + +  L   +       N+G
Sbjct: 100 FGIFNVGHRNPVVVSAVENQLAKQPLHSQELLDPLRAMLAKTLAALTPGKLKYSFFSNSG 159

Query: 104 TEAVETAIKMARKWGADIKNIDESSSEIIAMNGNFHGRTLGSLSLSSQDSYKKGFGPLLN 163
           TE+VE A+K+A+ + +            +A +G FHG++LG+LS +++ +++K F PLL 
Sbjct: 160 TESVEAALKLAKAYQSP-----RGKFTFVATSGAFHGKSLGALSATAKSTFRKPFMPLLP 214

Query: 164 NIHYADFGDIEQLKKLIN------NQTTAIILEPIQGEGGVNIPPTHFIQEVRQLCNEYN 217
              +  FGDI  ++ L++      +   A+ILEPIQGEGGV +PP  ++  VR+LC+E+ 
Sbjct: 215 GFRHVPFGDINAMRTLLSECKKTGDDVAAVILEPIQGEGGVILPPPGYLPAVRKLCDEFG 274

Query: 218 VLLIADEIQVGLGRTGKMFAMEWENTEPDIYLLGKSLGGGLYPISAVLANQDVMSVL--T 275
            LLI DE+Q G+GRTGKMFA E EN +PDI  L K+LGGG+ PI A +A ++V SVL   
Sbjct: 275 ALLILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFDN 334

Query: 276 PGTHGSTFGGNPLACAVSMAALDVLNEEHLVQNALDLGDRLLKHLQQIESE---LIVEVR 332
           P  H +TFGGNPLACA ++A ++VL  ++L   A   GD LL   +Q+  E   L+ EVR
Sbjct: 335 PFLHTTTFGGNPLACAAALATINVLLTQNLPAQAEQKGDMLLDGFRQLAREYPDLVNEVR 394

Query: 333 GRGLFIGIEL--NVAAQDYCEQMINKGVLCKETQGN--IIRIAPPLVIDKDEIDEVIR 386
           G+G+ + IE   N    D+  +M  + VL   T  N   IR+ PPL +  ++ ++V++
Sbjct: 395 GKGMLMAIEFVDNEIGYDFASEMFRQRVLVAGTLNNARTIRVEPPLTLTLEQCEQVLK 452


Lambda     K      H
   0.317    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 409
Number of extensions: 23
Number of successful extensions: 7
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 394
Length of database: 468
Length adjustment: 32
Effective length of query: 362
Effective length of database: 436
Effective search space:   157832
Effective search space used:   157832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory