GapMind for catabolism of small carbon sources

 

Aligments for a candidate for rocE in Klebsiella michiganensis M5al

Align Amino-acid permease RocE (characterized)
to candidate BWI76_RS06025 BWI76_RS06025 amino acid transporter

Query= SwissProt::P39137
         (467 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS06025 BWI76_RS06025 amino acid
           transporter
          Length = 468

 Score =  486 bits (1250), Expect = e-142
 Identities = 222/458 (48%), Positives = 322/458 (70%)

Query: 1   MNTNQDNGNQLQRTMKSRHLFMISLGGVIGTGFFLGTGFTINQAGPLGAVLSYLVGGFIM 60
           M T Q  G QL+RTMK+RHL M+SLGGVIGTG F  TG+ I+  G  G +L+YL+G  ++
Sbjct: 1   MQTTQQQGGQLKRTMKTRHLIMLSLGGVIGTGLFFNTGYIISTTGAAGTLLAYLIGALVV 60

Query: 61  FLTMLCLGELAVAFPVSGSFQTYATKFISPAFGFAFGWLYWLGWAVTCAIEFLSAGQLMQ 120
           +L M CLGEL+VA P +G+F  YA +++ PA G+   WLYWL W V     F +AG  MQ
Sbjct: 61  WLVMQCLGELSVAMPETGAFHVYAARYLGPATGYTVAWLYWLTWTVALGSSFTAAGFCMQ 120

Query: 121 RWFPHIDVWIWCLVFAALMFILNAITTKAFAESEFWFSGIKILIILLFIILGGAAMFGLI 180
            WFP + VW+WC+VF A++F LN I+T+ FAE EFWFS +K++ I+ FIILGGAA+FG+I
Sbjct: 121 YWFPQVPVWVWCVVFCAVIFALNVISTRFFAEGEFWFSLVKVITIIAFIILGGAAIFGII 180

Query: 181 DLKGGEQAPFLTHFYEDGLFPNGIKAMLITMITVNFAFQGTELIGVAAGESEDPEKTIPR 240
            ++ G  AP L +   +G FP+G   +L+TM+ VNFAF GTELIG+AAGE+E+P K IP 
Sbjct: 181 PMQDGSPAPGLRNITAEGWFPHGGLPILMTMVAVNFAFSGTELIGIAAGETENPHKVIPV 240

Query: 241 SIKQTVWRTLVFFVLSIIVIAGMIPWKQAGVVESPFVAVFEQIGIPYAADIMNFVILIAL 300
           +I+ T+ R ++FF+ ++ V+A +IP +QAGV +SPFV VFE++GIPYAADI NFVIL A+
Sbjct: 241 AIRTTIARLIIFFIGTVFVLAALIPMQQAGVEKSPFVLVFEKVGIPYAADIFNFVILTAI 300

Query: 301 LSVANSGLYASTRILYAMANEGQAFKALGKTNQRGVPMYSLIVTMAVACLSLLTKFAQAE 360
           LS ANSGLYAS R+L++++NE        K  + GVP+ ++ V+M    L+L +     +
Sbjct: 301 LSAANSGLYASGRMLWSLSNENTLPACFTKLTRNGVPLTAISVSMLGGVLALFSSVVAPD 360

Query: 361 TVYMVLLSLAGMSAQVGWITISLSQIMFRRKYIREGGKIEDLKFKTPLYPVLPLIGLTLN 420
           TV++ L +++G +    W++I  S  MFRR+++++G  + +L ++ P YP++P +G  L 
Sbjct: 361 TVFVALSAISGFAVVAVWLSICASHFMFRRRHLQQGKALSELHYRAPWYPLVPALGFVLC 420

Query: 421 TVVLISLAFDPEQRIALYCGVPFMIICYIIYHVVIKKR 458
            V  + LAFDP QRIAL+CG+PF+ +CY  Y++   ++
Sbjct: 421 LVACVGLAFDPSQRIALWCGIPFVALCYGAYYLTRSRK 458


Lambda     K      H
   0.329    0.142    0.438 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 640
Number of extensions: 27
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 467
Length of database: 468
Length adjustment: 33
Effective length of query: 434
Effective length of database: 435
Effective search space:   188790
Effective search space used:   188790
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory