Align agmatinase (EC 3.5.3.11) (characterized)
to candidate BWI76_RS21880 BWI76_RS21880 agmatinase
Query= BRENDA::Q9BSE5 (352 letters) >FitnessBrowser__Koxy:BWI76_RS21880 Length = 316 Score = 390 bits (1001), Expect = e-113 Identities = 191/308 (62%), Positives = 232/308 (75%) Query: 42 NQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAFIGVPLDTGTSNRPGARFGPRRIREES 101 +QP + R G +MMRLP + +GLDAAF+G+PLD GTS R G R+GPR IR ES Sbjct: 6 HQPQGGNEMPRFGGRATMMRLPFIDNLQGLDAAFVGIPLDIGTSQRSGTRYGPRYIRTES 65 Query: 102 VMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVAAGCIPLTLGGD 161 VM+ N +TGA PF SL VAD+GDV +N YNL S + I++ Y + + IPLTLGGD Sbjct: 66 VMIRPYNMATGAAPFDSLSVADIGDVPINTYNLLKSVQIIEDYYTGLNSFPLIPLTLGGD 125 Query: 162 HTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQ 221 HTIT PIL+A+ KKHGPVGL+H+DAHTDT D+ GEK+ HG FRR V+EGLLD KRVVQ Sbjct: 126 HTITLPILRALTKKHGPVGLIHIDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDLKRVVQ 185 Query: 222 IGIRGSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALD 281 IG R +++ +GFR+V AE CW KSL PLM EVRQQMG P+Y+SFDID+LD Sbjct: 186 IGQRAQGYAAGDFQWGVDRGFRLVQAEQCWHKSLAPLMAEVRQQMGDGPVYLSFDIDSLD 245 Query: 282 PAYAPGTGTPEIAGLTPSQALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFE 341 P +APGTGTPE+ GLT QALEI+RGC+GLN++GCDLVEVSPPYD+SGNT+ LAANLL+E Sbjct: 246 PIWAPGTGTPEVGGLTSIQALEIVRGCRGLNLIGCDLVEVSPPYDVSGNTSQLAANLLYE 305 Query: 342 MLCALPKV 349 MLC LP V Sbjct: 306 MLCVLPGV 313 Lambda K H 0.320 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 406 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 316 Length adjustment: 28 Effective length of query: 324 Effective length of database: 288 Effective search space: 93312 Effective search space used: 93312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate BWI76_RS21880 BWI76_RS21880 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.22296.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-62 198.1 0.0 1.4e-62 197.8 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS21880 BWI76_RS21880 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS21880 BWI76_RS21880 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 197.8 0.0 1.4e-62 1.4e-62 14 274 .. 36 308 .. 28 309 .. 0.92 Alignments for each domain: == domain 1 score: 197.8 bits; conditional E-value: 1.4e-62 TIGR01230 14 evvivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdaremvekie 83 ++ vgiP+d ts r G+r+gp ir+ s+ + y+ + ++ l v+D gd+p+ + + ++v+ ie lcl|FitnessBrowser__Koxy:BWI76_RS21880 36 DAAFVGIPLDIGTSQRSGTRYGPRYIRTESVMIRPYNMATGaAPFDSLSVADIGDVPINTYNLLKSVQIIE 106 55678********************************9998678******************99******* PP TIGR01230 84 evveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklshacvmrrvlelg. 153 ++ + l ++++GG+H+itlp++rA +kk++++ ++++DAHtD+ de gek+ h ++ rr++e g lcl|FitnessBrowser__Koxy:BWI76_RS21880 107 DYYTGLNSFPLIPLTLGGDHTITLPILRALTKKHGPVGLIHIDAHTDTNDEMFGEKIAHGTTFRRAVEEGl 177 **999999999*********************************************************998 PP TIGR01230 154 ...lnvlqigiRsg..ikeeadlarennikvlk.relede.....iaevlakvldkpvyvtiDiDvlDPaf 213 ++v+qig R++ ++++ ++ + ++++ + ++ +aev +++ d pvy+++DiD lDP + lcl|FitnessBrowser__Koxy:BWI76_RS21880 178 ldlKRVVQIGQRAQgyAAGDFQWGVDRGFRLVQaEQCWHKslaplMAEVRQQMGDGPVYLSFDIDSLDPIW 248 8889********97335678888888888776632222224455599************************ PP TIGR01230 214 aPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 aPG+gtpe+gGlts ++l+ v++ +++G+D+vEv+P yd s t +aa+l +e+l lcl|FitnessBrowser__Koxy:BWI76_RS21880 249 APGTGTPEVGGLTSIQALE-IVRGCRGLNLIGCDLVEVSPPYDVSGNTSQLAANLLYEMLC 308 *******************.999************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (316 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 8.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory