Align ATPase (characterized, see rationale)
to candidate BWI76_RS16795 BWI76_RS16795 amino acid ABC transporter ATPase
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Koxy:BWI76_RS16795 Length = 240 Score = 252 bits (643), Expect = 6e-72 Identities = 131/242 (54%), Positives = 180/242 (74%), Gaps = 3/242 (1%) Query: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 MI+ + K +G+ L G+S ++ EVV ++GPSGSGKSTFLR +NALE+ GE+ Sbjct: 1 MIHINNLHKRFGDS-HVLRGISCDIKPQEVVCIIGPSGSGKSTFLRCMNALETVSEGEVE 59 Query: 81 IEGHRLSHDRR-DIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATAR 139 + G +HDR D+ +R+ VGMVFQ+FNLFPH TVL+NL++AP+ +R A+A A Sbjct: 60 VNGFA-AHDRATDLNKMRESVGMVFQRFNLFPHKTVLENLIMAPMNLRGMARAEAVRLAE 118 Query: 140 QLLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDV 199 +LL +V ++++ D +P LSGGQQQRVAIARALAM+P I+LFDEPTSALDPE+V +VL+V Sbjct: 119 ELLAKVGLSDKRDAWPSSLSGGQQQRVAIARALAMKPSIMLFDEPTSALDPELVGDVLEV 178 Query: 200 MRDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQ 259 M++LASEGMTM++ THE+GFAREVADRV+ + G I EE P + F+AP + R FL++ Sbjct: 179 MKNLASEGMTMVIVTHEMGFAREVADRVIFIDQGIIQEEGKPAQIFSAPTNPRTAAFLSK 238 Query: 260 IL 261 +L Sbjct: 239 VL 240 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 201 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 240 Length adjustment: 24 Effective length of query: 237 Effective length of database: 216 Effective search space: 51192 Effective search space used: 51192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory