Align Amino acid ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine (characterized, see rationale)
to candidate BWI76_RS18355 BWI76_RS18355 amino acid ABC transporter permease
Query= uniprot:Q31RN9 (396 letters) >FitnessBrowser__Koxy:BWI76_RS18355 Length = 222 Score = 115 bits (289), Expect = 9e-31 Identities = 69/206 (33%), Positives = 116/206 (56%), Gaps = 6/206 (2%) Query: 190 GLLLTLATALISMVCSLPLGILLALGRQSSLPAIRWLSVTYIELFRGLPLVTILFFGQVM 249 G + TL ++ M L LG +LAL R S + I+WL+ YI +FRG PL+ LF Sbjct: 18 GAVFTLQLSIGGMFFGLVLGFILALMRMSPVWPIKWLARMYISIFRGTPLIAQLFMIYYG 77 Query: 250 VPLMLDSEWRIDRILRAIVGLTIFLSAYLAETVRGGLQAIPQGQFEAAAALGLNLFQTYR 309 +P +D I A++GL++ +AY AET+R + +I +GQ+EAAA++G+ +Q R Sbjct: 78 LPQF---GIELDPIPAAMIGLSLNTAAYAAETLRAAIASIDKGQWEAAASIGMTRWQAMR 134 Query: 310 FIVLPQALRISIPAIVGLFLNLLQDTTLLSIVGLLELLGISRSILANPAYLGRYAEVYLF 369 +LPQA R+++P + F++L++DT+L + + + EL ++ I + +YL Sbjct: 135 RAILPQAARVALPPLSNSFISLVKDTSLAATIQVPELFRQAQLITSRTL---EVFTMYLA 191 Query: 370 LGVLYWLCCYGLAQLSRRLEQRLTPQ 395 ++YW+ L+ L E +L Q Sbjct: 192 ASLIYWVMATVLSTLQNYFENQLNRQ 217 Lambda K H 0.329 0.142 0.471 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 222 Length adjustment: 26 Effective length of query: 370 Effective length of database: 196 Effective search space: 72520 Effective search space used: 72520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory