Align ABC transporter for L-asparagine and L-glutamate, permease component 1 (characterized)
to candidate BWI76_RS10280 BWI76_RS10280 polar amino acid ABC transporter permease
Query= reanno::pseudo1_N1B4:Pf1N1B4_772 (248 letters) >FitnessBrowser__Koxy:BWI76_RS10280 Length = 241 Score = 110 bits (276), Expect = 2e-29 Identities = 69/216 (31%), Positives = 114/216 (52%), Gaps = 14/216 (6%) Query: 25 YLSGLGWTIAIAVAAWIIALLLGSILGVMRTVPNRIVSGIATCYVELFRNVPLLVQLFIW 84 ++ G T+ I + + + ++LG +L +++ P R G+A Y+ LFR P+L Q+ Sbjct: 15 FVQGAWMTLLITLCSLLCGVVLGLVLALLQEAPFRAGKGLAFFYLWLFRGTPVLFQIIFV 74 Query: 85 YFLVPDLLPADIQEWYKQDLNPTTSAFLSVVVCLGLFTTARVCEQVRTGIQALPRGQEAA 144 Y ++P SAF V+ L L A + E +R+G+QA+ GQ A Sbjct: 75 YNVLPGF-------------GLRFSAFTCAVLALSLNEGAYMAEILRSGLQAVKSGQRTA 121 Query: 145 ARAMGFKLPQIYWNVLLPQAYRIIIPPLTSEFLNVFKNSSVASLIGLMELLAQTKQTAEF 204 A+G QI ++LPQA RI++PP+ ++ +++ K+S++ S+I + ELL QTA Sbjct: 122 GMALGMTSGQIMRKIVLPQAARIVLPPMGNQMISMLKSSALVSVIAVQELLLVANQTASA 181 Query: 205 SANLFEAFTLATLIYFTLNMSLMLLMRSVEKKVAVP 240 S FEA A IY+ L SL ++ +S + V P Sbjct: 182 SFRYFEALCAAG-IYYLLLTSLFMVFQSWLESVLDP 216 Lambda K H 0.326 0.140 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 248 Length of database: 241 Length adjustment: 24 Effective length of query: 224 Effective length of database: 217 Effective search space: 48608 Effective search space used: 48608 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory