Align ATPase (characterized, see rationale)
to candidate BWI76_RS10275 BWI76_RS10275 ABC transporter
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__Koxy:BWI76_RS10275 Length = 246 Score = 243 bits (621), Expect = 2e-69 Identities = 123/236 (52%), Positives = 165/236 (69%), Gaps = 1/236 (0%) Query: 26 GVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIWIEGHR 85 G++K +G Q L SL VQRGE VV++GPSGSGKST LR +N L G+++ Sbjct: 11 GIDKTFGRQ-TVLKNCSLEVQRGETVVLIGPSGSGKSTLLRCVNMLSPADSGDVFFASQH 69 Query: 86 LSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQLLERV 145 +S + +RQ +GMVFQ + LF HLT +N+MLAP+ V A A LL +V Sbjct: 70 ISRGEVPVHKLRQRIGMVFQNYELFSHLTAAENIMLAPMTVLGMNRTDARTLADNLLAKV 129 Query: 146 RIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVMRDLAS 205 RI E+AD +P +LSGGQQQRVAIARALAM+P ++L+DEPTSALDPEM+REVL+VM +L++ Sbjct: 130 RINERADHFPDELSGGQQQRVAIARALAMKPELMLYDEPTSALDPEMIREVLEVMAELSA 189 Query: 206 EGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFTAPQSDRAKQFLAQIL 261 EGMT +V THE+GFAR A++++ M DG+I++ A FF S+RA++FL QIL Sbjct: 190 EGMTSMVVTHEMGFARRAANKILFMEDGEIIDRASTSDFFAGNVSERAQRFLTQIL 245 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 246 Length adjustment: 24 Effective length of query: 237 Effective length of database: 222 Effective search space: 52614 Effective search space used: 52614 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory