Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate BWI76_RS12840 BWI76_RS12840 amino acid ABC transporter permease/ATP-binding protein
Query= uniprot:Q31RP0 (377 letters) >FitnessBrowser__Koxy:BWI76_RS12840 Length = 506 Score = 90.1 bits (222), Expect = 1e-22 Identities = 71/216 (32%), Positives = 111/216 (51%), Gaps = 28/216 (12%) Query: 173 WPQTPGWLVVIL-----AIALVL-FVSWLAQRQRSPRD--------WRWLYGAIAVVTVL 218 W T W V+ L A ++VL F+ LA ++SPR + WL+ ++ ++ +L Sbjct: 18 WQAT--WTVIKLSLLTWAFSIVLGFI--LALAKQSPRKLFNAPARLYIWLFRSMPLLVLL 73 Query: 219 MLLTQLSWPQQLQPGQIRGGLRLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEA 278 + + + PQ L L+ F A LL +V A+I EI RGG+LS+P GQ EA Sbjct: 74 IFVYNM--PQALPSF----APVLNDPFWAGLLAMVLSEAAYIAEIHRGGLLSIPKGQSEA 127 Query: 279 AAALGLTRSQTLWQIVVPQALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQ 338 A ALGL + T W++V+PQALRV +P+L ++Y+ K SSL + ++ Q +Q Sbjct: 128 ARALGLRYAGTQWRVVIPQALRVALPALANEYIAIVKLSSLVSVISLTEILMVGQRLYSQ 187 Query: 339 TGRPVEVFLILMLTYLAINAVISAGMNGLQQRLQRW 374 +E + Y+ I V + L +RL+ W Sbjct: 188 NFLVMETMAAVAFYYILIVTV----FDFLLKRLETW 219 Score = 25.0 bits (53), Expect = 0.005 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 7/77 (9%) Query: 92 VIAIGLI---LTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQLI-VWYFPILL 147 VI + L+ + V+G + +A S L +R Y+ + R+ PLL+ LI V+ P L Sbjct: 24 VIKLSLLTWAFSIVLGFILALAKQSPRKLFNAPARLYIWLFRSMPLLVLLIFVYNMPQAL 83 Query: 148 S--LPAAQQPWHWLGSL 162 P P+ W G L Sbjct: 84 PSFAPVLNDPF-WAGLL 99 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 391 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 506 Length adjustment: 32 Effective length of query: 345 Effective length of database: 474 Effective search space: 163530 Effective search space used: 163530 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory