Align D-cellobiose transporter (MFS superfamily) (characterized)
to candidate BWI76_RS17695 BWI76_RS17695 MFS transporter
Query= reanno::SB2B:6937231 (444 letters) >FitnessBrowser__Koxy:BWI76_RS17695 Length = 452 Score = 355 bits (910), Expect = e-102 Identities = 179/431 (41%), Positives = 267/431 (61%), Gaps = 2/431 (0%) Query: 2 LSVREKIAYGLGDTASNIVFQTVMLFLTFFYTDIFGISAAYVGTMFLAVRIMDAVTDPLM 61 +SVREK+ Y LGD AS+IVF + + L +FYTDI+G+ A +GTMFL VR++DA+TDP+M Sbjct: 7 ISVREKVGYSLGDAASHIVFDSSVAILAYFYTDIYGLPPAVMGTMFLLVRLLDAITDPIM 66 Query: 62 GYLADRTNTRWGRYRPYLLWFAFPFAAISVLAFTTPDLSESGKEWYAFATYALLMLAYTA 121 G +AD T+TRWGR+RP+LL PFA VL ++ P S+SGK YA A Y + L YTA Sbjct: 67 GAIADATSTRWGRFRPWLLAICVPFAVSCVLVYSIPSFSDSGKIVYAVAAYIFMTLMYTA 126 Query: 122 INIPYCALGAALTTNPAERVSVQSYRFVFAMLGGVMVSALTLPLVDFFGQGDKAKGYQLT 181 INIPYC+LGAALT++P E +S+QS+RF +GG + +A LPL DF GD+A G Q++ Sbjct: 127 INIPYCSLGAALTSDPRESLSLQSWRFAITPIGGALGTAFILPLADFLYPGDRATGIQVS 186 Query: 182 ILAMSIVGTVMFLLCFIGTKERDFSSDDNSGNFKAASKALWANDQWRVLSAAAIFLLTGL 241 + ++G +MF++CF TKER + + N K L+ NDQWR+LS +L + Sbjct: 187 MALFGVIGCLMFVICFATTKERVQPIKEENLNIARDVKILFRNDQWRILSVYNFMMLVAV 246 Query: 242 VLKSTLAIYYVKYFLGR-EDMISVFVTSGVVGNIFGVALAKKLADKMCKVKAYIRLQLIA 300 V++ +YYV L + D+I++F+ G+ ++ G LAK + CKV+ + L+ Sbjct: 247 VIRGGAVVYYVNNVLNKGSDVITIFMLGGMFASMLGSVLAKPFGTRFCKVRFSFWINLLT 306 Query: 301 AALCMAAWFVPADQYVLALVFYIAWNFTINMGTPLLWAKMADTVDYGQFKTGVRTTGLVY 360 AAL + + +P ++ L +I + L W+ + D +YG++KT R TG+ Sbjct: 307 AALGVVCFMLPVQYWIAVLGVHILISIIQGGNGALQWSMITDVNNYGEWKTQRRITGMNV 366 Query: 361 SSVIFFIKLGLAIGGALGGWLLAAYGYQPDVA-QTEETRAGILLCFTLYPALASIAVAFV 419 ++ IF IKLG+A+GGA+ GW+LA Y Y + A Q G++L FTL P++ + A Sbjct: 367 AANIFVIKLGVAVGGAILGWVLAYYHYAANTAVQPASAVQGVVLLFTLVPSIFYVLTAIS 426 Query: 420 MRHYTLDSQRV 430 ++ Y L R+ Sbjct: 427 IKFYGLTENRM 437 Lambda K H 0.327 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 517 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 452 Length adjustment: 33 Effective length of query: 411 Effective length of database: 419 Effective search space: 172209 Effective search space used: 172209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory