GapMind for catabolism of small carbon sources

 

Alignments for a candidate for celEIIA in Klebsiella michiganensis M5al

Align PTS system N,N'-diacetylchitobiose-specific EIIA component; EIIA-Chb; EIII-Chb; IIIcel; N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component (characterized)
to candidate BWI76_RS01515 BWI76_RS01515 PTS family cellobiose transporter subunit IIA

Query= SwissProt::P69791
         (116 letters)



>FitnessBrowser__Koxy:BWI76_RS01515
          Length = 105

 Score =  101 bits (252), Expect = 2e-27
 Identities = 47/100 (47%), Positives = 74/100 (74%)

Query: 15  EELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEG 74
           E+LE ++M L++N+G ARS A  AL+ A++GDFAAA+  M +S   +  AH +QT+LI  
Sbjct: 2   EDLETIIMELLVNAGSARSSALTALQLARKGDFAAAEQAMTESHEFVKHAHKIQTQLIGM 61

Query: 75  DAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKL 114
           D G GK+ V+L+ VH+QDHLM +M+ ++L T++IEL+ ++
Sbjct: 62  DEGSGKLPVNLITVHSQDHLMNAMVIQDLATDMIELYRRI 101


Lambda     K      H
   0.315    0.128    0.329 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 53
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 116
Length of database: 105
Length adjustment: 12
Effective length of query: 104
Effective length of database: 93
Effective search space:     9672
Effective search space used:     9672
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.1 bits)
S2: 40 (20.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory