Align L-malate/citrate:H+ symporter (electroneutral) (characterized)
to candidate BWI76_RS04555 BWI76_RS04555 citrate/acetate antiporter
Query= TCDB::P94363 (450 letters) >FitnessBrowser__Koxy:BWI76_RS04555 Length = 451 Score = 425 bits (1092), Expect = e-123 Identities = 217/429 (50%), Positives = 298/429 (69%), Gaps = 2/429 (0%) Query: 21 KENWFAKAMNIKVGIIPLPVYALLFILITVFVMHHDVKSDILTSIAVMAFFGFTFAQIGK 80 K+ W+ N KVGIIPLP++ L LI + + + SDI+ +A +AFFGF + GK Sbjct: 23 KQRWWHILDNWKVGIIPLPLFLLAGGLIALDCLGGKLPSDIVVMVATLAFFGFACGEFGK 82 Query: 81 SIPIVRSIGGPAILATFIPSAVVYYHLLPNDIVKSTTEFTENSNFLYLFIAGIVVGSILG 140 +PI+ +G AI ATFIPSA+V+Y LLP+ +V+STT+F +++N LYL+I I+VGSI+ Sbjct: 83 RLPILGKLGAAAICATFIPSALVHYGLLPDVVVESTTKFYKSTNILYLYICCIIVGSIMS 142 Query: 141 MKRETLVKAFMKIFIPLIVGSVTAAIVGLAVGTLLGLGFQHTLLYIVIPIMAGGVGEGAI 200 M R TL++ FM+IF P++ G + +VG+ VGT LGL +IV+PIMAGGVGEGAI Sbjct: 143 MNRTTLIQGFMRIFFPMLCGEIVGMVVGVGVGTALGLEPFQVFFFIVLPIMAGGVGEGAI 202 Query: 201 PLSIGYSDIMPISQGEAFALVLPSIMLGSLCAIILAGLLNRIGKKKPEWTGNGKVDRSEE 260 PLSIGY+ +M + QG A VLP +MLGSL AI++AG LN++GK+ P TG G++ + Sbjct: 203 PLSIGYAALMHMDQGVALGRVLPMVMLGSLTAIVIAGGLNQLGKRFPHLTGEGQLMPNRR 262 Query: 261 ESPALEESQSGQQMFNLSLFASGGILAVSLYLVGMLAHDFFGFPAPVAMLLLAVLIKLFR 320 E G+ +++ ASG +LAV LY++GML G PAPV ML LAVL+KL Sbjct: 263 NETHRETPAEGK--MDVTTLASGALLAVLLYMLGMLGQKTIGLPAPVGMLFLAVLLKLVN 320 Query: 321 LVPASIENGAFGVSRFFSTAVTYPLLFAIGVSMTPWDKLVAAFNLSNIITILSVVVTMMA 380 V ++ G+ V +FF TAVTYP+LFA+GV++TPW +LV AF L+N++ I+S V ++A Sbjct: 321 GVSPRLQEGSQMVYKFFRTAVTYPILFAVGVAITPWQELVNAFTLTNLLVIISTVSALVA 380 Query: 381 VGFFTGKWLNMYPIETAIINACHSGQGGTGDVAILSAAERLELMPFAQVSTRIGGAITVS 440 GF GK + M+PI+ AI++ C SGQGGTGDVAIL++ R+ LMPFAQ++TRIGGAI VS Sbjct: 381 TGFLVGKKIGMHPIDVAIVSCCQSGQGGTGDVAILTSGNRMNLMPFAQIATRIGGAINVS 440 Query: 441 LTLLLLHQF 449 L LL L F Sbjct: 441 LGLLFLSHF 449 Lambda K H 0.326 0.141 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 672 Number of extensions: 44 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 450 Length of database: 451 Length adjustment: 33 Effective length of query: 417 Effective length of database: 418 Effective search space: 174306 Effective search space used: 174306 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory