Align The pmf-dependent citrate uptake system, Cit1 (characterized)
to candidate BWI76_RS04375 BWI76_RS04375 anion transporter
Query= TCDB::Q6D017 (484 letters) >FitnessBrowser__Koxy:BWI76_RS04375 Length = 477 Score = 283 bits (725), Expect = 7e-81 Identities = 162/471 (34%), Positives = 265/471 (56%), Gaps = 11/471 (2%) Query: 14 MIVILVIAAFFWQMEPPAGLNPAAWHSAVIFVATIVCIVANVLPIGAIGIISITLFALTY 73 ++VI+ I P GL+ AW + I++A IV +V + P ++ I + A Sbjct: 9 LLVIIAIPLLISLFPAPEGLSKLAWVLSGIYLAAIVGLV--IKPFAEPVVLLIAVAASMV 66 Query: 74 AAGDKTASGAIQTA--LSDLNSSLIWLIVVAFMIARGFIKTGLGRRIALQMIRLLGKRTL 131 G+ G+I+ A LS +S WL+ AF ++ F+ TGLG+RIA +I +G TL Sbjct: 67 VVGN-LGDGSIKAASVLSGYSSGTTWLVFSAFTLSAAFVITGLGKRIAYILIGKIGSTTL 125 Query: 132 GLAYGLAFADLVLSPAMPSNTARCGGIIYPIADSLSRSFDSKPEDASRSKIGTFLITCIG 191 GL Y AF DL+L+PA PSNTAR GGI+ PI +S++ + S+PE S ++G +L+ + Sbjct: 126 GLGYVTAFLDLILAPATPSNTARAGGIVLPIINSVAVALGSEPE-RSAKRVGHYLMLNVY 184 Query: 192 NVNDVTAAMFMTAYTGNLLAVKLAAN-AGVTITWGSWFLAALVPCLISLAIVPLLVYWLT 250 V T+ MF TA GN+LA+K+ + + ++WG W LAA +P +I L + PL+ Y L Sbjct: 185 MVTKTTSYMFFTAMAGNILALKMIEDICHIKLSWGGWALAAGLPGIIMLLLTPLITYKLY 244 Query: 251 KPEIRHTPDAPKLAVAELAKMGSISRGEWLMAFTVILLLVLWIFGDRLGVDATTASFVGL 310 PE++ D K+A A + +G ++ E +++ +L L W+F LGV+ +T + + Sbjct: 245 PPELKKV-DNKKIAKAGMEALGPMTLREKMLSCLFVLALGGWVFSQSLGVNESTVAIGVM 303 Query: 311 SFLLLTGVLSWEDVKNEKGAWDTLIWFAALLMMANQLKKLGFTNWFGDLIGSNIGHLMQG 370 + +L+ +++W+DV KG W+TLIW+ ++ +++ L K+GF W DL+ +NI G Sbjct: 304 ALMLVLRIVTWDDVIKNKGGWNTLIWYGGIIGLSSLLSKVGFFLWLADLLKNNISFNGHG 363 Query: 371 TSWVLVLLLLNAAYFYTHYFFASGNAQIAALFAVFLGVGINLNIPAVPMAFMLAFTSSLY 430 +V++ L+ YFFASG+A I A+ VF + P + A L F++S Sbjct: 364 NVAFIVIVALS---ILVRYFFASGSAYIVAMVPVFAMLANVSGAPVMLTALALLFSNSYG 420 Query: 431 CSLTQYTHARGPILFGAGYVPTAVWWRTGFVVSLVNQAIFMGAGLLWWKAI 481 +T Y A GP++FG GY WW G +++L+ + + G+ WW+ + Sbjct: 421 GMVTHYGGAAGPVIFGVGYNDIKSWWIIGGILALLTFLLQITLGVWWWEIL 471 Lambda K H 0.327 0.139 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 787 Number of extensions: 44 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 484 Length of database: 477 Length adjustment: 34 Effective length of query: 450 Effective length of database: 443 Effective search space: 199350 Effective search space used: 199350 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory