Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate BWI76_RS11375 BWI76_RS11375 iron-dicitrate transporter permease subunit
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__Koxy:BWI76_RS11375 Length = 332 Score = 468 bits (1205), Expect = e-137 Identities = 236/323 (73%), Positives = 271/323 (83%) Query: 10 LWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLRLPRSLVAVL 69 +WGLP+ AL +FWLSLFCYS IP+S +A ALL TP L EALV NLRLPRSLVA++ Sbjct: 10 IWGLPLLALTGLFWLSLFCYSPIPISPLNALHALLAPDTPALAEALVLNLRLPRSLVAIM 69 Query: 70 IGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALSPTPIAGYSLSFIAACGG 129 +GASLA++G LLQTLTHNP+ASPSLLGINSGAALA+ALTSA SP P+AG+SL+ IAACGG Sbjct: 70 LGASLAMSGALLQTLTHNPLASPSLLGINSGAALAIALTSAFSPAPLAGFSLALIAACGG 129 Query: 130 GVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAEDHAYGIFYWLAGGV 189 G+SWLLVMTAGGG+R DR++LILAGIALSA CM L+R+TLLLAED A+GI WLAGGV Sbjct: 130 GLSWLLVMTAGGGWRQQLDRHRLILAGIALSALCMALSRMTLLLAEDRAWGILTWLAGGV 189 Query: 190 SHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTRLRLVINMLVLLL 249 SH RW + WQL P P V LLAN LNLLN+ D+ AH+LGVNL RLRL+IN VLLL Sbjct: 190 SHVRWAEFWQLFPFFALIAPGVFLLANALNLLNVGDTAAHSLGVNLPRLRLLINAAVLLL 249 Query: 250 VGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLADVLARALAFPGD 309 GA VSVAGPVAFIGLLVPHLARF AG D R +LP+S +LGA LMLLAD+LARALA+PG+ Sbjct: 250 TGASVSVAGPVAFIGLLVPHLARFCAGHDHRFLLPMSAVLGALLMLLADILARALAWPGE 309 Query: 310 LPAGAVLALIGSPCFVWLVRRRG 332 LPAGAVLAL+G+PCFVWLVRRRG Sbjct: 310 LPAGAVLALVGAPCFVWLVRRRG 332 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 465 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 332 Length adjustment: 28 Effective length of query: 304 Effective length of database: 304 Effective search space: 92416 Effective search space used: 92416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory