Align Fe(3+) dicitrate transport system permease protein FecC; Iron(III) dicitrate transport system permease protein FecC (characterized)
to candidate BWI76_RS22470 BWI76_RS22470 transporter permease
Query= SwissProt::P15030 (332 letters) >FitnessBrowser__Koxy:BWI76_RS22470 Length = 331 Score = 191 bits (484), Expect = 3e-53 Identities = 118/334 (35%), Positives = 189/334 (56%), Gaps = 20/334 (5%) Query: 6 HPVL-LWGLPVAALIIIFWLSLFCYSAIPVSGADATRALLPGHTPTLPEALVQNLRLPRS 64 HP LW + + +++ + +P++ +LLP L + +RLPR Sbjct: 4 HPARHLWLMTLLLIVLTLLATTLGAMRLPLT------SLLPAGDEILRNIWL-TIRLPRV 56 Query: 65 LVAVLIGASLALAGTLLQTLTHNPMASPSLLGINSGAALAMALTSALS---PTPIAGYS- 120 L+A+L+GA+LAL+G ++Q L NP+A P LLGI+ GAALA+A L P +A Y+ Sbjct: 57 LLALLVGAALALSGCVMQGLFRNPLADPGLLGISGGAALAVACWLVLPLSLPALVALYAP 116 Query: 121 --LSFIAACGGGVSWLLVMTAGGGFRHTHDRNKLILAGIALSAFCMGLTRITLLLAED-H 177 +FI + V ++ AG ++L+L GIA++A C L + ++ D Sbjct: 117 MLAAFIGSTAVMVVIFILSQAGDA-----SLSRLLLVGIAINALCGALVGVLAWISNDTQ 171 Query: 178 AYGIFYWLAGGVSHARWQDVWQLLPVVVTAVPVVLLLANQLNLLNLSDSTAHTLGVNLTR 237 + W G + A W + +++ A VV +A++LNLL L D AH LGVN+ Sbjct: 172 LRQLSLWGMGSLGQAEWSTLLVAATLMIPASLVVWAMASRLNLLQLGDEEAHYLGVNVRA 231 Query: 238 LRLVINMLVLLLVGACVSVAGPVAFIGLLVPHLARFWAGFDQRNVLPVSMLLGATLMLLA 297 L+ ++ + LLV + V+++G + FIGL+VPHL R W G D R ++P S+L GA L+LLA Sbjct: 232 LQRLLLLCSALLVASAVAISGIIGFIGLVVPHLMRMWLGPDHRGLVPGSLLCGAILLLLA 291 Query: 298 DVLARALAFPGDLPAGAVLALIGSPCFVWLVRRR 331 D LAR +A P ++P G + +++G+P F+WL+ R+ Sbjct: 292 DTLARTVAAPAEMPVGLLTSVLGAPWFLWLIFRQ 325 Lambda K H 0.327 0.140 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 374 Number of extensions: 25 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 331 Length adjustment: 28 Effective length of query: 304 Effective length of database: 303 Effective search space: 92112 Effective search space used: 92112 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory