Align iron(III) dicitrate transport system permease protein FecD (characterized)
to candidate BWI76_RS16825 BWI76_RS16825 heme ABC transporter
Query= CharProtDB::CH_004160 (318 letters) >FitnessBrowser__Koxy:BWI76_RS16825 Length = 341 Score = 182 bits (461), Expect = 1e-50 Identities = 118/324 (36%), Positives = 183/324 (56%), Gaps = 10/324 (3%) Query: 2 KIALVIFITLALAGCALLSLHMG---VIPVPWRALLTDWQAGHEHYYVLMEYRLPRLLLA 58 ++ALV+ ++L L G +L+ L +G + P L + + + ++++ RL RL A Sbjct: 16 RLALVL-LSLLLLGGSLVHLGLGARWIAPQTVLQALFHYDPRNFDHRIIVDLRLVRLAAA 74 Query: 59 LFVGAALAVAGVLIQGIVRNPLASPDILGVNHAASLASVGALLLMPSLPVMVL--PLLAF 116 L GAAL VAG+L+Q ++RNPL P ILG+N ASLA V L SL + L PL A Sbjct: 75 LLTGAALGVAGLLLQTVIRNPLGEPHILGLNAGASLAVVATSALGISLGGVALARPLTAA 134 Query: 117 AGG---MAGLILLKMLAKTH-QPMKLALTGVALSACWASLTDYLMLSRPQDVNNALLWLT 172 G G++LL + P+++ L GVALSA +++T +++ Q + WL Sbjct: 135 CGAALLFGGVMLLSSSGRGGVTPLRITLCGVALSAFASAVTAAILILDEQTLLAMRTWLA 194 Query: 173 GSLWGRDWSFVKIAIPLMILFLPLSLSFCRDLDLLALGDARATTLGVSVPHTRFWALLLA 232 G L G +W ++ A+ + + ++L+ L++LALGD A LGV + TR L Sbjct: 195 GDLAGLNWQTLRAALLPALAGVTVALAIAPRLNVLALGDKVALGLGVKIVQTRLLGLAAI 254 Query: 233 VAMTSTGVAACGPISFIGLVVPHMMRSITGGRHRRLLPVSALTGALLLVVADLLARIIHP 292 + + VA GPI F+GLVVPH +R + R LP++A GAL+L++AD+ AR + Sbjct: 255 ALLCGSAVAVAGPIGFVGLVVPHAVRRLISEDIRLALPLAAPVGALVLLLADIAARTLVA 314 Query: 293 PLELPVGVLTAIIGAPWFVWLLVR 316 P EL G +TA++GAP F+++ R Sbjct: 315 PQELATGAMTALVGAPVFIFIAAR 338 Lambda K H 0.330 0.142 0.447 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 295 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 341 Length adjustment: 28 Effective length of query: 290 Effective length of database: 313 Effective search space: 90770 Effective search space used: 90770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory