Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate BWI76_RS19240 BWI76_RS19240 ABC transporter substrate-binding protein
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__Koxy:BWI76_RS19240 Length = 257 Score = 201 bits (512), Expect = 1e-56 Identities = 109/251 (43%), Positives = 153/251 (60%), Gaps = 4/251 (1%) Query: 9 AALL--LPLCATAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLEVKC 66 AALL + L A AQ++ I FGV YPPF+ +A G + GFDI++ NA+C +L+ KC Sbjct: 6 AALLACMALSAPLAAQQFDTISFGVDGGYPPFDVLAPSGEITGFDIDIANALCTQLKAKC 65 Query: 67 TWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADFGDT 126 +V F+ MI AL A KFDAI++S+ +T R+K +DF+DR + S ++ RK + Sbjct: 66 VFVKQPFESMIAALNAHKFDAIIASLNITDERKKEVDFTDRYYRSAAQLVARKGSPLLPD 125 Query: 127 PESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDKLEA 186 SL GK VGV GS EA+A+A+ A G +I Y +QD Y DL +GR+DA L D ++A Sbjct: 126 AASLKGKTVGVQTGSTHEAFAKANWANHGVKIVGYANQDNVYLDLLSGRIDAALQDNIQA 185 Query: 187 QLNFLSKPEGSDFK-TGPAFKDPTLPLDIAMGLRKNDQALRALINKGIAAVQADGTYAQI 245 F+ P G F GP +D + D+ + + K++ ALR +N I A++ADGTY I Sbjct: 186 ATGFIDTPRGQKFAFAGPVIQDGGISSDVGIAVNKDNPALRDALNGAIKAIRADGTYDAI 245 Query: 246 QKKYFGDQDIY 256 QKKYF DIY Sbjct: 246 QKKYF-SFDIY 255 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory