Align ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale)
to candidate BWI76_RS20340 BWI76_RS20340 histidine ABC transporter substrate-binding protein HisJ
Query= uniprot:A0A1N7UK26 (258 letters) >FitnessBrowser__Koxy:BWI76_RS20340 Length = 260 Score = 209 bits (531), Expect = 6e-59 Identities = 114/256 (44%), Positives = 163/256 (63%), Gaps = 5/256 (1%) Query: 7 LFAALLLPLCA--TAHAQEWKEIRFGVFPEYPPFESVAADGSLQGFDIELGNAICAKLEV 64 L +L++ +C+ +A A + IR G Y PF S A G GFDI+LGN +C++++V Sbjct: 6 LALSLMMGICSASSAFAALPQSIRIGTDATYAPFSSKDAKGDFVGFDIDLGNELCSRIKV 65 Query: 65 KCTWVHNEFDGMIPALRARKFDAIMSSMAVTPAREKIIDFSDRLFLSPTSVITRKSADFG 124 KCTWV ++FD +IP+L+A+K DAI+SS+++T R++ I FSD+L+ + + +I K + Sbjct: 66 KCTWVGSDFDSLIPSLKAKKIDAIISSLSITEKRQQEIAFSDKLYAADSRLIAAKGSPIQ 125 Query: 125 DTPESLMGKQVGVLQGSLQEAYARAHLAKLGAQIKAYQSQDQNYADLQNGRLDATLTDKL 184 T ESL GK VGVLQGS QEAY G + AYQ+QD Y+DL GRLDA L D++ Sbjct: 126 PTLESLKGKHVGVLQGSTQEAYGNERWRSHGVDVVAYQNQDLIYSDLSAGRLDAALQDEV 185 Query: 185 EAQLNFLSKPEGSDFK-TGPAFKDPTLPLD-IAMGLRKNDQALRALINKGIAAVQADGTY 242 A FL +P G DF GP+ KD D +GLRK+D L+A +K +A ++ DGTY Sbjct: 186 AASEGFLKQPAGKDFAFAGPSVKDKKFFGDGTGIGLRKDDSELKAAFDKALADMRKDGTY 245 Query: 243 AQIQKKYFGDQDIYHE 258 ++ KKYF D ++Y E Sbjct: 246 DKMAKKYF-DFNVYGE 260 Lambda K H 0.319 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 185 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 260 Length adjustment: 24 Effective length of query: 234 Effective length of database: 236 Effective search space: 55224 Effective search space used: 55224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory