Align ABC transporter permease; SubName: Full=Amino acid ABC transporter permease; SubName: Full=Histidine ABC transporter permease HisM; SubName: Full=Histidine transport system permease protein; SubName: Full=Histidine/lysine/arginine/ornithine ABC transporter permease HisM (characterized, see rationale)
to candidate BWI76_RS16800 BWI76_RS16800 amino acid ABC transporter permease
Query= uniprot:A0A1N7U128 (237 letters) >FitnessBrowser__Koxy:BWI76_RS16800 Length = 254 Score = 108 bits (271), Expect = 8e-29 Identities = 80/250 (32%), Positives = 128/250 (51%), Gaps = 32/250 (12%) Query: 3 ELFQQYGLAYLFSDGAGLSGVAMTLWLFIISVVLGFFLSIPLALARVS--EH-VW----- 54 E+ ++YG LF DGA MT+ II V+LG + L L R++ EH VW Sbjct: 7 EIIEEYGP--LFMDGA-----LMTIKCTIICVILGTLWGLTLGLGRMAKAEHGVWKYVLR 59 Query: 55 --LRWPVEVYTYLFRGTPLYIQLLICYTGLYSLEI-VQDNALLNQFFRNA---------- 101 +++PV Y FRGTPL++Q+++ + L L I +D L+ +A Sbjct: 60 YLVQFPVRFYVSAFRGTPLFVQIMVVHFALVPLFINPRDGLLVTSGMMSADFARELRSNY 119 Query: 102 ---LNCTLLAFVLNTCAYTVEIFAGAIRNIPHGEIEAARAYGLHGWRLNLFVVVPAALRR 158 L+C ++A LN AY EIF I++I G++EA+RA G+ W+ V++P A RR Sbjct: 120 GAFLSC-IVAITLNAGAYVSEIFRAGIQSIDKGQMEASRALGMPWWKTMRQVILPQAFRR 178 Query: 159 ALPAYSNEMILMLHATSLAFTATVADILKVARDANAETFLTFQAFGIAALLYMLLSFALV 218 LP N I ++ +SLA +AD+ AR + ++ + +L+Y +++F L Sbjct: 179 ILPPLGNNAIAIVKDSSLASAIGLADLAYAARTVSGAYATYWEPYLTISLVYWVITFLLA 238 Query: 219 GLFRLAERRW 228 L E+R+ Sbjct: 239 QLVNRLEKRF 248 Lambda K H 0.332 0.143 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 167 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 237 Length of database: 254 Length adjustment: 24 Effective length of query: 213 Effective length of database: 230 Effective search space: 48990 Effective search space used: 48990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory