GapMind for catabolism of small carbon sources

 

Aligments for a candidate for arcC in Klebsiella michiganensis M5al

Align Carbamate kinase; EC 2.7.2.2 (characterized, see rationale)
to candidate BWI76_RS07060 BWI76_RS07060 carbamate kinase

Query= uniprot:P13982
         (310 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS07060 BWI76_RS07060 carbamate
           kinase
          Length = 297

 Score =  270 bits (690), Expect = 3e-77
 Identities = 150/298 (50%), Positives = 191/298 (64%), Gaps = 10/298 (3%)

Query: 3   IVVALGGNALLRRGEPMTADNQRENVRIAAEQIAKVAPGNELVIAHGNGPQVGLLALQGA 62
           +VVALGGNALL+RGE +T +NQ  N+  A   +A++A    L I HGNGPQVGLL+LQ  
Sbjct: 4   LVVALGGNALLQRGEALTVENQYRNIDSAVPALARLAQKYRLAIVHGNGPQVGLLSLQNL 63

Query: 63  AYDKVSPYPLDVLGAETEGMIGYMIEQEMGN--LLPFEVPFATILTQVEVDGKDPAFQNP 120
           AY  V PYPLDVL AE++GMIGYM+ Q +    L+P   P +T++T++ V   DPAF  P
Sbjct: 64  AYGDVEPYPLDVLVAESQGMIGYMLAQRLAQEALMP---PVSTVMTRIAVASNDPAFSAP 120

Query: 121 TKPIGPVYSREEAERLAAEKGWSIAPDGDKFRRVVPSPRPKRIFEIRPVKWLLEKGTIVI 180
            K IGPVY  E   +L AE GW++  DG   RRVVPSP P RI E   ++ LL +G  VI
Sbjct: 121 EKFIGPVYEPELQAQLEAEYGWTMKRDGKYLRRVVPSPTPVRIEESESIERLLGEGHAVI 180

Query: 181 CAGGGGIPTMYDEAGKKLSGVEAVIDKDLCSSLLAQELVADILIIATDVDAAYVDWGKPT 240
           C GGGGIP +  E G+   G EAVIDKDL ++LLA+++ AD L+I TD DA Y  WG P 
Sbjct: 181 CCGGGGIPVL--ECGR---GAEAVIDKDLAAALLAEQINADGLVILTDADAVYEHWGTPM 235

Query: 241 QKAIAQAHPDELERLGFAAGSMGPKVQAAIEFARATGKDAVIGSLADIVAITEGKAGT 298
           Q+ I +A P+ L       G+MGPK+ A   + R  GK A IG+L+ I     G AGT
Sbjct: 236 QRPIREATPEALAPFARNDGAMGPKIAAVSGYVRRRGKRAWIGALSRIDDTLAGLAGT 293


Lambda     K      H
   0.317    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 269
Number of extensions: 14
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 310
Length of database: 297
Length adjustment: 27
Effective length of query: 283
Effective length of database: 270
Effective search space:    76410
Effective search space used:    76410
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 48 (23.1 bits)

Align candidate BWI76_RS07060 BWI76_RS07060 (carbamate kinase)
to HMM TIGR00746 (arcC: carbamate kinase (EC 2.7.2.2))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00746.hmm
# target sequence database:        /tmp/gapView.17554.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00746  [M=309]
Accession:   TIGR00746
Description: arcC: carbamate kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   1.9e-118  381.0   0.0   2.1e-118  380.8   0.0    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS07060  BWI76_RS07060 carbamate kinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS07060  BWI76_RS07060 carbamate kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  380.8   0.0  2.1e-118  2.1e-118       1     308 [.       2     296 ..       2     297 .] 0.97

  Alignments for each domain:
  == domain 1  score: 380.8 bits;  conditional E-value: 2.1e-118
                               TIGR00746   1 kkvvvaLGGnallqrgekasaeeqrknvekaakqlvklakrgyelvithGngPqvGalllqneaadsvpak 71 
                                             k++vvaLGGnallqrge++++e+q++n+ +a+++l++la+  y+l+i+hGngPqvG l lqn a+ +v+++
  lcl|FitnessBrowser__Koxy:BWI76_RS07060   2 KTLVVALGGNALLQRGEALTVENQYRNIDSAVPALARLAQ-KYRLAIVHGNGPQVGLLSLQNLAYGDVEPY 71 
                                             689***********************************99.9***************************** PP

                               TIGR00746  72 PldvlgaesqgliGYllqqalkeelakeglekkvatvltqvivdekDeaFqnPtkpigpfydeeeakrlaa 142
                                             Pldvl+aesqg+iGY+l+q l +e    +l+ +v tv+t++ v ++D+aF+ P+k+igp+y++e + +l+a
  lcl|FitnessBrowser__Koxy:BWI76_RS07060  72 PLDVLVAESQGMIGYMLAQRLAQE----ALMPPVSTVMTRIAVASNDPAFSAPEKFIGPVYEPELQAQLEA 138
                                             ********************9955....459**************************************** PP

                               TIGR00746 143 ekgailkedagrgwRrvvpsPkPkeiveaeviktLvekgvivissgGGGvPvvkdgkelkGveaviDkDla 213
                                             e+g+++k+ +g+++RrvvpsP P++i e+e i+ L+ +g+ vi++gGGG+Pv + g   +G eaviDkDla
  lcl|FitnessBrowser__Koxy:BWI76_RS07060 139 EYGWTMKR-DGKYLRRVVPSPTPVRIEESESIERLLGEGHAVICCGGGGIPVLECG---RGAEAVIDKDLA 205
                                             ********.9*******************************************544...68********** PP

                               TIGR00746 214 sekLaeevnaDilviltdvdavyvnygkpdekkleevkveeleelakdgefaaGsmgPkveaaiefvesrg 284
                                             +++Lae++naD lviltd+davy+++g+p ++ ++e+++e l+ +a     ++G+mgPk+ a++ +v+ rg
  lcl|FitnessBrowser__Koxy:BWI76_RS07060 206 AALLAEQINADGLVILTDADAVYEHWGTPMQRPIREATPEALAPFA----RNDGAMGPKIAAVSGYVRRRG 272
                                             **********************************************....889****************** PP

                               TIGR00746 285 kkaiitslekivealegkaGtvvv 308
                                             k+a+i++l++i ++l+g aGt++ 
  lcl|FitnessBrowser__Koxy:BWI76_RS07060 273 KRAWIGALSRIDDTLAGLAGTCIK 296
                                             **********************96 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (309 nodes)
Target sequences:                          1  (297 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.55
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory