GapMind for catabolism of small carbon sources

 

Aligments for a candidate for astC in Klebsiella michiganensis M5al

Align succinylornithine transaminase (EC 2.6.1.81) (characterized)
to candidate BWI76_RS26000 BWI76_RS26000 aspartate aminotransferase family protein

Query= BRENDA::O30508
         (406 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS26000 BWI76_RS26000 aspartate
           aminotransferase family protein
          Length = 406

 Score =  538 bits (1385), Expect = e-157
 Identities = 266/404 (65%), Positives = 312/404 (77%)

Query: 1   MSAPHAQVERADFDRYMVPNYAPAAFIPVRGEGSRVWDQSGRELIDFAGGIAVTSLGHAH 60
           M+     + RA FD  ++P YAPA FIPV+G+GSRVWDQ G+E +DFAGGIAVT+LGH H
Sbjct: 1   MATEQPAITRATFDEVILPIYAPAEFIPVKGKGSRVWDQQGKEYVDFAGGIAVTALGHCH 60

Query: 61  PALVKALTEQAQRIWHVSNVFTNEPALRLARKLVDATFAERVFLANSGAEANEAAFKLAR 120
           PALV AL EQ +++WH SNVFTNEPALRL RKLVDATFA+RV   NSG EANE AFKLAR
Sbjct: 61  PALVAALHEQGEKLWHTSNVFTNEPALRLGRKLVDATFADRVVFMNSGTEANETAFKLAR 120

Query: 121 RYANDVYGPQKYEIIAASNSFHGRTLFTVNVGGQPKYSDGFGPKFEGITHVPYNDLEALK 180
            Y    + P K +IIA  N+FHGR+LFTV+VGGQPKYSDGFGPK   I HVP+NDL A+K
Sbjct: 121 HYTVTRHSPYKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFGPKPADIVHVPFNDLHAVK 180

Query: 181 AAISDKTCAVVLEPIQGEGGVLPAQQAYLEGARKLCDEHNALLVFDEVQSGMGRVGELFA 240
           A + D TCAVV+EPIQGEGGV  A   +L+G R LCD+H ALLVFDEVQ GMGR G LFA
Sbjct: 181 AVMDDHTCAVVVEPIQGEGGVTAATPEFLQGLRDLCDQHQALLVFDEVQCGMGRTGSLFA 240

Query: 241 YMHYGVVPDILSSAKSLGGGFPIGAMLTTGEIAKHLSVGTHGTTYGGNPLASAVAEAALD 300
           YMHYGV PDIL+SAK+LGGGFPI AMLTT +IA     G+HG+TYGGNPLA AV  AA D
Sbjct: 241 YMHYGVTPDILTSAKALGGGFPISAMLTTHDIASAFHAGSHGSTYGGNPLACAVGGAAFD 300

Query: 301 VINTPEVLDGVKAKHERFKSRLQKIGQEYGIFDEIRGMGLLIGAALTDEWKGKARDVLNA 360
           +INTPEVLDGV AK E F   LQ+I   + +F +IRGMGLLIGA L  ++ GKARD L A
Sbjct: 301 LINTPEVLDGVTAKRELFVQHLQQIDARFDLFSDIRGMGLLIGAELKPQYHGKARDFLYA 360

Query: 361 AEKEAVMVLQASPDVVRFAPSLVIDDAEIDEGLERFERAVAKLV 404
           A +  VMVL A PDV+RF PSLVIDD++I EG+ RF +AV +++
Sbjct: 361 AAEAGVMVLNAGPDVMRFVPSLVIDDSDIAEGMARFAQAVERVL 404


Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 545
Number of extensions: 21
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 406
Length of database: 406
Length adjustment: 31
Effective length of query: 375
Effective length of database: 375
Effective search space:   140625
Effective search space used:   140625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS26000 BWI76_RS26000 (aspartate aminotransferase family protein)
to HMM TIGR03246 (astC: succinylornithine transaminase family (EC 2.6.1.81))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR03246.hmm
# target sequence database:        /tmp/gapView.28503.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR03246  [M=397]
Accession:   TIGR03246
Description: arg_catab_astC: succinylornithine transaminase family
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   3.5e-208  677.3   0.3     4e-208  677.1   0.3    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS26000  BWI76_RS26000 aspartate aminotra


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS26000  BWI76_RS26000 aspartate aminotransferase family protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  677.1   0.3    4e-208    4e-208       1     396 [.       8     403 ..       8     404 .. 1.00

  Alignments for each domain:
  == domain 1  score: 677.1 bits;  conditional E-value: 4e-208
                               TIGR03246   1 veresfdevmvpvyapakfipvrgeGsrvwdqegkeyidfaGGiavnalGhahpelvealkeqaeklwhlg 71 
                                             ++r++fdev++p+yapa+fipv+g+Gsrvwdq+gkey+dfaGGiav+alGh+hp+lv+al+eq+eklwh++
  lcl|FitnessBrowser__Koxy:BWI76_RS26000   8 ITRATFDEVILPIYAPAEFIPVKGKGSRVWDQQGKEYVDFAGGIAVTALGHCHPALVAALHEQGEKLWHTS 78 
                                             79********************************************************************* PP

                               TIGR03246  72 ngytnepvlrlakklvdatfadkvffcnsGaeaneaalklarkvaldkygaekseivafknsfhGrtlftv 142
                                             n++tnep+lrl +klvdatfad+v f nsG+eane+a+klar++++ ++++ k++i+af+n+fhGr+lftv
  lcl|FitnessBrowser__Koxy:BWI76_RS26000  79 NVFTNEPALRLGRKLVDATFADRVVFMNSGTEANETAFKLARHYTVTRHSPYKTKIIAFHNAFHGRSLFTV 149
                                             *********************************************************************** PP

                               TIGR03246 143 svGGqakysedfaplpegikhaayndlealkalisdktcavivepiqGegGvvpadkaflkglrelcdrhn 213
                                             svGGq+kys++f+p+p++i h+++ndl+a+ka+++d+tcav+vepiqGegGv++a+++fl+glr+lcd+h+
  lcl|FitnessBrowser__Koxy:BWI76_RS26000 150 SVGGQPKYSDGFGPKPADIVHVPFNDLHAVKAVMDDHTCAVVVEPIQGEGGVTAATPEFLQGLRDLCDQHQ 220
                                             *********************************************************************** PP

                               TIGR03246 214 allifdevqtGvGrtGelyaymeyGvtpdiltsakalGgGfpiGalltteelakvlkvGthGttyGGnpla 284
                                             all+fdevq G+GrtG+l+aym+yGvtpdiltsakalGgGfpi a+ltt+++a++++ G+hG+tyGGnpla
  lcl|FitnessBrowser__Koxy:BWI76_RS26000 221 ALLVFDEVQCGMGRTGSLFAYMHYGVTPDILTSAKALGGGFPISAMLTTHDIASAFHAGSHGSTYGGNPLA 291
                                             *********************************************************************** PP

                               TIGR03246 285 cavaekvldlvntaelleGvkqrhelfvdelekinarykvfseirGkGlliGavlteeyaGkakdlvnaaa 355
                                             cav ++ +dl+nt+e+l+Gv ++ elfv++l++i+ar+++fs+irG+GlliGa+l+ +y+Gka+d++ aaa
  lcl|FitnessBrowser__Koxy:BWI76_RS26000 292 CAVGGAAFDLINTPEVLDGVTAKRELFVQHLQQIDARFDLFSDIRGMGLLIGAELKPQYHGKARDFLYAAA 362
                                             *********************************************************************** PP

                               TIGR03246 356 eeGvlvliaGpdvvrfapslvieeeeikeGlarlekavekl 396
                                             e+Gv+vl aGpdv+rf pslvi++++i+eG+ar+++ave++
  lcl|FitnessBrowser__Koxy:BWI76_RS26000 363 EAGVMVLNAGPDVMRFVPSLVIDDSDIAEGMARFAQAVERV 403
                                             **************************************997 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (397 nodes)
Target sequences:                          1  (406 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 8.64
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory