Align Glutarate-semialdehyde dehydrogenase; EC 1.2.1.- (characterized)
to candidate BWI76_RS13210 BWI76_RS13210 aldehyde dehydrogenase
Query= SwissProt::Q9I6M5 (483 letters) >FitnessBrowser__Koxy:BWI76_RS13210 Length = 479 Score = 346 bits (888), Expect = e-100 Identities = 187/468 (39%), Positives = 278/468 (59%), Gaps = 1/468 (0%) Query: 14 YVDGAWVDADNGQTIKVNNPATGEIIGSVPKMGAAETRRAIEAADKALPAWRALTAKERA 73 Y+DG + I V NPAT ++ +P A + RRAI AA++A P W AL A ERA Sbjct: 10 YIDGQFEPGRGDAWIDVINPATEALLSRIPDGSAEDARRAILAAERAQPGWEALPAIERA 69 Query: 74 NKLRRWFDLMIENQDDLARLMTIEQGKPLAEAKGEIAYAASFLEWFGEEAKRIYGDTIPG 133 LR+ + E +++A L+ E GK A E+++ A +L++ E A+R G+ + Sbjct: 70 RWLRKIAAGIRERAEEIAALIVAEGGKIQQLAAVEVSFTADYLDYMAEWARRYEGEIVQS 129 Query: 134 HQPDKRIIVIKQPIGVTAAITPWNFPSAMITRKAGPALAAGCTMVLKPASQTPYSALALA 193 + + I+V K+ +GVT I PWNFP +I RK PAL G T+V+KP+ TP +A+A A Sbjct: 130 DRTGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEFTPNNAIAFA 189 Query: 194 ELAERAGIPKGVFSVVTGSAGEVGGELTSNPIVRKLTFTGSTEIGRQLMAECAQDIKKVS 253 ++ G+PKGVF++V G VG EL SNP V ++ TGS G ++MA A++I KV Sbjct: 190 QIVHDIGLPKGVFNLVLGRGETVGQELASNPKVAMVSMTGSVAAGEKIMAAAAKNITKVC 249 Query: 254 LELGGNAPFIVFDDADLDAAVEGALISKYRNNGQTCVCANRLYVQDGVYDAFVDKLKAAV 313 LELGG AP IV DDADL+ AV+ + S+ N+GQ C C R+YVQ G+YD FV++L A+ Sbjct: 250 LELGGKAPAIVMDDADLELAVKAVVDSRVINSGQVCNCVERVYVQKGIYDRFVNRLGEAL 309 Query: 314 AKLNIGN-GLEAGVTTGPLIDAKAVAKVEEHIADAVSKGAKVVSGGKPHALGGTFFEPTI 372 + G+ + GPLI+A A+A+VE+ +A AV++GA+V GGK G F+ PT+ Sbjct: 310 KAVQFGDPASRDDIAMGPLINAAALARVEQKVAKAVAQGARVALGGKAVTGRGYFYPPTL 369 Query: 373 LVDVPKNALVSKDETFGPLAPVFRFKDEAEVIAMSNDTEFGLASYFYARDLARVFRVAEQ 432 L+DV + + +ETFGP+ PV F E +AM+ND+++GL S Y RDL + + Sbjct: 370 LLDVRQEMDIVHEETFGPVLPVVAFDTLEEALAMANDSDYGLTSSIYTRDLNVAMKAIKG 429 Query: 433 LEYGMVGINTGLISNEVAPFGGIKASGLGREGSKYGIEDYLEIKYLCL 480 L++G IN G + SG+G ++G+ +YL+ + + L Sbjct: 430 LKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLNEYLQTQVVYL 477 Lambda K H 0.317 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 566 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 483 Length of database: 479 Length adjustment: 34 Effective length of query: 449 Effective length of database: 445 Effective search space: 199805 Effective search space used: 199805 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory