GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Klebsiella michiganensis M5al

Align phosphopentomutase (EC 5.4.2.7) (characterized)
to candidate BWI76_RS04140 BWI76_RS04140 phosphopentomutase

Query= BRENDA::P0A6K6
         (407 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS04140 BWI76_RS04140
           phosphopentomutase
          Length = 407

 Score =  790 bits (2041), Expect = 0.0
 Identities = 379/406 (93%), Positives = 394/406 (97%)

Query: 1   MKRAFIMVLDSFGIGATEDAERFGDVGADTLGHIAEACAKGEADNGRKGPLNLPNLTRLG 60
           MKRAFIMVLDSFGIGATEDA+RFGDVG+DT+GHIAEACAKGEADNGRKGPLNLPNLTRLG
Sbjct: 1   MKRAFIMVLDSFGIGATEDADRFGDVGSDTMGHIAEACAKGEADNGRKGPLNLPNLTRLG 60

Query: 61  LAKAHEGSTGFIPAGMDGNAEVIGAYAWAHEMSSGKDTPSGHWEIAGVPVLFEWGYFSDH 120
           L KAHEGSTG + AGMDG+AEVIGAYAWAHE+SSGKDTPSGHWEIAGVPVLF+WGYF +H
Sbjct: 61  LVKAHEGSTGKVAAGMDGSAEVIGAYAWAHELSSGKDTPSGHWEIAGVPVLFDWGYFPEH 120

Query: 121 ENSFPQELLDKLVERANLPGYLGNCHSSGTVILDQLGEEHMKTGKPIFYTSADSVFQIAC 180
           ENSFPQELLDKLV+RANLPGYLGNCHSSGTVILDQLGEEHMKTGKPIFYTSADSVFQIAC
Sbjct: 121 ENSFPQELLDKLVKRANLPGYLGNCHSSGTVILDQLGEEHMKTGKPIFYTSADSVFQIAC 180

Query: 181 HEETFGLDKLYELCEIAREELTNGGYNIGRVIARPFIGDKAGNFQRTGNRHDLAVEPPAP 240
           HEET+GLDKLYELCEIAREELT GGYNIGRVIARPFIGDKAGNFQRTGNRHDLAVEPPAP
Sbjct: 181 HEETYGLDKLYELCEIAREELTEGGYNIGRVIARPFIGDKAGNFQRTGNRHDLAVEPPAP 240

Query: 241 TVLQKLVDEKHGQVVSVGKIADIYANCGITKKVKATGLDALFDATIKEMKEAGDNTIVFT 300
           TVLQKLVDEK GQVVSVGKIADIYANCGITKKVKATGLDALFDAT+KEMKEAGD TIVFT
Sbjct: 241 TVLQKLVDEKKGQVVSVGKIADIYANCGITKKVKATGLDALFDATVKEMKEAGDETIVFT 300

Query: 301 NFVDFDSSWGHRRDVAGYAAGLELFDRRLPELMSLLRDDDILILTADHGCDPTWTGTDHT 360
           NFVDFDSSWGHRRDVAGYAAGLELFDRRLPELM L+ +DDILILTADHGCDPTWTGTDHT
Sbjct: 301 NFVDFDSSWGHRRDVAGYAAGLELFDRRLPELMELVGEDDILILTADHGCDPTWTGTDHT 360

Query: 361 REHIPVLVYGPKVKPGSLGHRETFADIGQTLAKYFGTSDMEYGKAM 406
           REHIPVL+YGPKVKPGSLGHRETFADIGQTLA YFGTS M+YGK M
Sbjct: 361 REHIPVLIYGPKVKPGSLGHRETFADIGQTLATYFGTSAMDYGKNM 406


Lambda     K      H
   0.318    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 820
Number of extensions: 28
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 407
Length of database: 407
Length adjustment: 31
Effective length of query: 376
Effective length of database: 376
Effective search space:   141376
Effective search space used:   141376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)

Align candidate BWI76_RS04140 BWI76_RS04140 (phosphopentomutase)
to HMM TIGR01696 (deoB: phosphopentomutase (EC 5.4.2.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01696.hmm
# target sequence database:        /tmp/gapView.14766.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01696  [M=381]
Accession:   TIGR01696
Description: deoB: phosphopentomutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
   1.3e-205  668.5   0.0   1.5e-205  668.3   0.0    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS04140  BWI76_RS04140 phosphopentomutase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS04140  BWI76_RS04140 phosphopentomutase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  668.3   0.0  1.5e-205  1.5e-205       1     380 [.       3     404 ..       3     405 .. 0.99

  Alignments for each domain:
  == domain 1  score: 668.3 bits;  conditional E-value: 1.5e-205
                               TIGR01696   1 rvflivldsvGiGeaedaadfkdeGadtlghiaealdk..........lnlpnleklGlgkiee......l 55 
                                             r+f++vlds+GiG++eda++f+d+G+dt+ghiaea++k          lnlpnl++lGl k++e       
  lcl|FitnessBrowser__Koxy:BWI76_RS04140   3 RAFIMVLDSFGIGATEDADRFGDVGSDTMGHIAEACAKgeadngrkgpLNLPNLTRLGLVKAHEgstgkvA 73 
                                             89******************************************************************999 PP

                               TIGR01696  56 agvdaveevlayyaklseassGkdtmtGhweiaGlnilkefkvfs...ngfpeelldkleeragrk.vlgn 122
                                             ag+d+++ev+++ya+++e+ssGkdt++GhweiaG+++l+++++f+   n+fp+elldkl++ra+++ +lgn
  lcl|FitnessBrowser__Koxy:BWI76_RS04140  74 AGMDGSAEVIGAYAWAHELSSGKDTPSGHWEIAGVPVLFDWGYFPeheNSFPQELLDKLVKRANLPgYLGN 144
                                             9********************************************9999********************** PP

                               TIGR01696 123 kpasGtvildelGeehmktGklivytsadsvlqiaaheevvpleelyelcekarellkdpkyliGriiarp 193
                                             +++sGtvild+lGeehmktGk+i+ytsadsv+qia+hee+ +l++lyelce+are+l++++y+iGr+iarp
  lcl|FitnessBrowser__Koxy:BWI76_RS04140 145 CHSSGTVILDQLGEEHMKTGKPIFYTSADSVFQIACHEETYGLDKLYELCEIAREELTEGGYNIGRVIARP 215
                                             *********************************************************************** PP

                               TIGR01696 194 fvGe.aGnfkrtsnrhdyalkpfaktvldklkdeky.dvisiGkiadiydgeGitkkvrtksnmdgldkvi 262
                                             f+G+ aGnf+rt+nrhd+a++p+a+tvl+kl+dek  +v+s+Gkiadiy+++Gitkkv+++++++++d+++
  lcl|FitnessBrowser__Koxy:BWI76_RS04140 216 FIGDkAGNFQRTGNRHDLAVEPPAPTVLQKLVDEKKgQVVSVGKIADIYANCGITKKVKATGLDALFDATV 286
                                             ***********************************99********************************** PP

                               TIGR01696 263 kelkedftg.isfanlvdfdalyGhrrdkeGyaaaleefdarlpellsklreddlliltadhGndptatGt 332
                                             ke+ke++++ i+f+n+vdfd+++Ghrrd++Gyaa+le fd+rlpel+ ++ edd+liltadhG+dpt+tGt
  lcl|FitnessBrowser__Koxy:BWI76_RS04140 287 KEMKEAGDEtIVFTNFVDFDSSWGHRRDVAGYAAGLELFDRRLPELMELVGEDDILILTADHGCDPTWTGT 357
                                             ********99************************************************************* PP

                               TIGR01696 333 dhtreyipvlvyspkvkkgqalesaetfadiGatladnfntskpeyGk 380
                                             dhtre+ipvl+y+pkvk+g +l+++etfadiG+tla +f+ts ++yGk
  lcl|FitnessBrowser__Koxy:BWI76_RS04140 358 DHTREHIPVLIYGPKVKPG-SLGHRETFADIGQTLATYFGTSAMDYGK 404
                                             *******************.***************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (381 nodes)
Target sequences:                          1  (407 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 7.07
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory