GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoC in Klebsiella michiganensis M5al

Align deoxyribose-phosphate aldolase (EC 4.1.2.4) (characterized)
to candidate BWI76_RS04130 BWI76_RS04130 2-deoxyribose-5-phosphate aldolase

Query= BRENDA::Q7WT44
         (259 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS04130 BWI76_RS04130
           2-deoxyribose-5-phosphate aldolase
          Length = 259

 Score =  494 bits (1272), Expect = e-145
 Identities = 251/259 (96%), Positives = 258/259 (99%)

Query: 1   MTDLSASSLRALKLMDLTTLNDDDTNEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTL 60
           MTDL+ASSLRALKLMDLTTLNDDDTNEKVIALCHQAKTPVGNTAA+CIYPRFIPIARKTL
Sbjct: 1   MTDLTASSLRALKLMDLTTLNDDDTNEKVIALCHQAKTPVGNTAAVCIYPRFIPIARKTL 60

Query: 61  NAQGTPDIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFD 120
           N QGTPDIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFD
Sbjct: 61  NEQGTPDIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFD 120

Query: 121 LVKACKEACAAANVLLKVIIETGELKEEALIRKASEISIKAGADFIKTSTGKVPVNATPE 180
           LVKACKEACAAANVLLKVIIETGELKE+ALIRKASEI+IKAGADFIKTSTGKVPVNATPE
Sbjct: 121 LVKACKEACAAANVLLKVIIETGELKEDALIRKASEIAIKAGADFIKTSTGKVPVNATPE 180

Query: 181 SARIMLEVIRDMGVQKTVGFKPAGGVRSAEDAQQFLAIADELFGADWADSRHYRFGASSL 240
           SARIMLEVIRDMGVQ++VGFKPAGGVRSAEDAQ+FLAIADELFGADWADSRHYRFGASSL
Sbjct: 181 SARIMLEVIRDMGVQQSVGFKPAGGVRSAEDAQKFLAIADELFGADWADSRHYRFGASSL 240

Query: 241 LASLLKALGHGDGKSASSY 259
           LASLLKALGHGDGKSASSY
Sbjct: 241 LASLLKALGHGDGKSASSY 259


Lambda     K      H
   0.318    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 328
Number of extensions: 4
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 259
Length of database: 259
Length adjustment: 24
Effective length of query: 235
Effective length of database: 235
Effective search space:    55225
Effective search space used:    55225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate BWI76_RS04130 BWI76_RS04130 (2-deoxyribose-5-phosphate aldolase)
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00126.hmm
# target sequence database:        /tmp/gapView.11191.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00126  [M=211]
Accession:   TIGR00126
Description: deoC: deoxyribose-phosphate aldolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                               Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                               -----------
    1.7e-88  281.6   1.3      2e-88  281.4   1.3    1.0  1  lcl|FitnessBrowser__Koxy:BWI76_RS04130  BWI76_RS04130 2-deoxyribose-5-ph


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Koxy:BWI76_RS04130  BWI76_RS04130 2-deoxyribose-5-phosphate aldolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  281.4   1.3     2e-88     2e-88       2     210 ..      11     232 ..      10     233 .. 0.98

  Alignments for each domain:
  == domain 1  score: 281.4 bits;  conditional E-value: 2e-88
                               TIGR00126   2 lakliDhtalkadtteedietlcaeAkky..kfaavcvnpsyvslAkelLk..gt.eveictvvgFPlGas 67 
                                             ++kl+D+t+l++d+t+e++++lc++Ak++  ++aavc++p+++++A+++L+  gt +++i+tv++FP+G++
  lcl|FitnessBrowser__Koxy:BWI76_RS04130  11 ALKLMDLTTLNDDDTNEKVIALCHQAKTPvgNTAAVCIYPRFIPIARKTLNeqGTpDIRIATVTNFPHGND 81 
                                             689**************************99*******************988999*************** PP

                               TIGR00126  68 ttevkllEakeaieeGAdEvDvviniaalkdkneevviedikavveaca..kvllKvilEtalLtdeekk. 135
                                             +++++l+E+++ai++GAdEvDvv++++al ++ne+v+++ +ka++eaca  +vllKvi+Et++L++++++ 
  lcl|FitnessBrowser__Koxy:BWI76_RS04130  82 DIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFDLVKACKEACAaaNVLLKVIIETGELKEDALIr 152
                                             ************************************************999*****************988 PP

                               TIGR00126 136 kAseisieagadfvKtstgfsakgAtvedvrlmkkvvgd.....evgvKasGGvrtaedalalieagaeri 201
                                             kAsei+i+agadf+Ktstg++ ++At+e++r+m +v++d     +vg+K++GGvr aeda++++++++e++
  lcl|FitnessBrowser__Koxy:BWI76_RS04130 153 KASEIAIKAGADFIKTSTGKVPVNATPESARIMLEVIRDmgvqqSVGFKPAGGVRSAEDAQKFLAIADELF 223
                                             **************************************9999999************************** PP

                               TIGR00126 202 gasaavaii 210
                                             ga++a+ ++
  lcl|FitnessBrowser__Koxy:BWI76_RS04130 224 GADWADSRH 232
                                             *****9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (211 nodes)
Target sequences:                          1  (259 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00
# Mc/sec: 6.26
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory