Align purine-nucleoside phosphorylase (EC 2.4.2.1) (characterized)
to candidate BWI76_RS01010 BWI76_RS01010 uridine phosphorylase
Query= BRENDA::Q72IR2 (235 letters) >FitnessBrowser__Koxy:BWI76_RS01010 Length = 249 Score = 135 bits (340), Expect = 7e-37 Identities = 84/228 (36%), Positives = 124/228 (54%), Gaps = 12/228 (5%) Query: 14 AERVLLPGDPGRAEWIAKTFLQNPRRYNDHRGLWGYTGLYKGVPVSVQTTGMGTPSAAIV 73 A LLPGDP R + IA FL NP+ +R G Y+GV + V +TG+G P AI Sbjct: 16 ARYALLPGDPQRVDRIAN-FLDNPQPLGQNREFRAARGWYQGVEILVLSTGIGGPFTAIA 74 Query: 74 VEELVRLGARVLVRVGTAGAASSDLAPGELIVAQGAVPLDGTTRQYLEGRPYAPVPDPEV 133 +EEL ++G L+R+G+ GA +LA G++I+A AV DGT+R Y Y DP++ Sbjct: 75 IEELRQIGVTTLIRIGSCGALQDNLALGDVIIAHAAVMDDGTSRTYAPA-GYPACADPQL 133 Query: 134 FRALWRRAEALGYPHRVGLVASEDAFYATTPEEARA-WARYGVLAFEMEASALFLLGRMR 192 L +A + P GLV S D+FY E A W+ G+L +ME++AL +G +R Sbjct: 134 TWELMAQARQMNIPAACGLVRSHDSFYTDREAELDAQWSARGILGADMESAALMTIGALR 193 Query: 193 GVRTGAILAV--------SNRIGDPELAPPEVLQEGVRRMVEVALEAV 232 G+RT ++L V + I D + + Q+G R + +AL A+ Sbjct: 194 GLRTASLLNVVVAHNGCLDSSIND-YVQQEALCQQGEERQITLALRAI 240 Lambda K H 0.320 0.137 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 134 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 249 Length adjustment: 23 Effective length of query: 212 Effective length of database: 226 Effective search space: 47912 Effective search space used: 47912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory