Align purine-nucleoside phosphorylase (EC 2.4.2.1) (characterized)
to candidate BWI76_RS04145 BWI76_RS04145 purine-nucleoside phosphorylase
Query= BRENDA::P0ABP8 (239 letters) >FitnessBrowser__Koxy:BWI76_RS04145 Length = 240 Score = 448 bits (1153), Expect = e-131 Identities = 226/240 (94%), Positives = 233/240 (97%), Gaps = 1/240 (0%) Query: 1 MATPHINAEMGDFADVVLMPGDPLRAKYIAETFLEDAREVNNVRGMLGFTGTYKGRKISV 60 MATPHINAEMGDFADVVLMPGDPLRAK+IAETFLED REVNNVRGMLGFTGTYKGRKISV Sbjct: 1 MATPHINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISV 60 Query: 61 MGHGMGIPSCSIYTKELITDFGVKKIIRVGSCGAVLPHVKLRDVVIGMGACTDSKVNRIR 120 MGHGMGIPSCSIY KELITDFGVKKIIRVGSCGAV VKLRDVVIGMGACTDSKVNR+R Sbjct: 61 MGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRMR 120 Query: 121 FKDHDFAAIADFDMVRNAVDAAKALGIDARVGNLFSADLFYSPD-GEMFDVMEKYGILGV 179 FKDHDFAAIADF MVRNAVDAAKALG+DARVGN+FSADLFY+PD GEMFDVMEKYGILGV Sbjct: 121 FKDHDFAAIADFGMVRNAVDAAKALGVDARVGNIFSADLFYAPDGGEMFDVMEKYGILGV 180 Query: 180 EMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTTAAERQTTFNDMIKIALESVLLGDKE 239 EMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQT++AERQTTFNDMIKIALESVLLGDKE Sbjct: 181 EMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTSSAERQTTFNDMIKIALESVLLGDKE 240 Lambda K H 0.322 0.138 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 239 Length of database: 240 Length adjustment: 23 Effective length of query: 216 Effective length of database: 217 Effective search space: 46872 Effective search space used: 46872 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
Align candidate BWI76_RS04145 BWI76_RS04145 (purine-nucleoside phosphorylase)
to HMM TIGR00107 (deoD: purine nucleoside phosphorylase (EC 2.4.2.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00107.hmm # target sequence database: /tmp/gapView.9827.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00107 [M=232] Accession: TIGR00107 Description: deoD: purine nucleoside phosphorylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.5e-128 411.3 1.0 6.2e-128 411.1 1.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS04145 BWI76_RS04145 purine-nucleoside Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS04145 BWI76_RS04145 purine-nucleoside phosphorylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.1 1.0 6.2e-128 6.2e-128 1 230 [. 5 235 .. 5 237 .. 0.99 Alignments for each domain: == domain 1 score: 411.1 bits; conditional E-value: 6.2e-128 TIGR00107 1 hinakkgdiadvvllpGdPlrakyiaekfledakevnevrgmlgftGkykgkkisvmGhGmGipsisiysk 71 hina++gd+advvl+pGdPlrak+iae+fled++evn+vrgmlgftG+ykg+kisvmGhGmGips+siy+k lcl|FitnessBrowser__Koxy:BWI76_RS04145 5 HINAEMGDFADVVLMPGDPLRAKHIAETFLEDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAK 75 9********************************************************************** PP TIGR00107 72 elikeyevkkiirvGsCGairkkvklkdviialkastdskvnrvrfvevdlaaiadfelvklakeaakkkg 142 eli++++vkkiirvGsCGa+r++vkl+dv+i+++a+tdskvnr+rf+++d+aaiadf +v++a++aak++g lcl|FitnessBrowser__Koxy:BWI76_RS04145 76 ELITDFGVKKIIRVGSCGAVRMDVKLRDVVIGMGACTDSKVNRMRFKDHDFAAIADFGMVRNAVDAAKALG 146 *********************************************************************** PP TIGR00107 143 ldvkvGnvfsadlfystd.kevldllekygvlavemeaaalyavaaelgkkaltlltvsdhlvthealtae 212 +d++vGn+fsadlfy +d e++d++ekyg+l+vemeaa++y+vaae+g+kalt++tvsdh++the+++++ lcl|FitnessBrowser__Koxy:BWI76_RS04145 147 VDARVGNIFSADLFYAPDgGEMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTHEQTSSA 217 ****************98459************************************************** PP TIGR00107 213 erqktfkdmielalesvs 230 erq+tf+dmi++alesv+ lcl|FitnessBrowser__Koxy:BWI76_RS04145 218 ERQTTFNDMIKIALESVL 235 ****************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (232 nodes) Target sequences: 1 (240 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.61 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory