GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pta in Klebsiella michiganensis M5al

Align Phosphate propanoyltransferase; Phosphate acyltransferase PduL; Phosphotransacylase PduL; PTAC; Propanediol utilization protein PduL; EC 2.3.1.222 (characterized)
to candidate BWI76_RS23150 BWI76_RS23150 propanediol utilization phosphotransacylase

Query= SwissProt::Q9XDN5
         (210 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS23150 BWI76_RS23150 propanediol
           utilization phosphotransacylase
          Length = 210

 Score =  387 bits (995), Expect = e-113
 Identities = 196/210 (93%), Positives = 203/210 (96%)

Query: 1   MDKELLQSTVRKVLDEMRQRPIPLGVSNRHIHLSAQDYERLFPGHPISEKKALLQPGQYA 60
           MDK+LL+STV KVLDEMR RPIPLGVSNRHIHLSA DYERLFPGHPISEKKALLQPGQYA
Sbjct: 1   MDKQLLESTVSKVLDEMRLRPIPLGVSNRHIHLSAADYERLFPGHPISEKKALLQPGQYA 60

Query: 61  AEQTVTLVGPKGQLKNVRLLGPLRSVSQVEISRTDARTLGIAAPLRMSGNLKGTPGIRLV 120
           AEQTVTLVGPKGQLKNVRLLGPLRSVSQVEISRTDARTLG+AAPLRMSGNLKGTPGIRLV
Sbjct: 61  AEQTVTLVGPKGQLKNVRLLGPLRSVSQVEISRTDARTLGVAAPLRMSGNLKGTPGIRLV 120

Query: 121 SPFAELELPSGVIVAQRHIHMSPLDALILRVSHGDMVSVAIEGDDRGLIFNNVAIRVSPD 180
           SPF ELEL SGVIVAQRHIHMSPLDALILRV+HGD VSVAIEGD+RGLIFNNVA+RVSPD
Sbjct: 121 SPFGELELTSGVIVAQRHIHMSPLDALILRVAHGDRVSVAIEGDERGLIFNNVAVRVSPD 180

Query: 181 MRLEMHIDTDEANAAGADNPHAFARLVGPR 210
           MRLEMHIDTDEANAAGAD+P AFARLVGPR
Sbjct: 181 MRLEMHIDTDEANAAGADSPQAFARLVGPR 210


Lambda     K      H
   0.319    0.136    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 295
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 210
Length of database: 210
Length adjustment: 21
Effective length of query: 189
Effective length of database: 189
Effective search space:    35721
Effective search space used:    35721
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory