Align Acetyl-CoA C-acetyltransferase (EC 2.3.1.9) (characterized)
to candidate BWI76_RS23710 BWI76_RS23710 acetyl-CoA acetyltransferase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2411 (393 letters) >FitnessBrowser__Koxy:BWI76_RS23710 Length = 396 Score = 362 bits (929), Expect = e-104 Identities = 196/389 (50%), Positives = 254/389 (65%), Gaps = 2/389 (0%) Query: 5 EIYVVSAARTAIGTFGGSLKDVPLADLATTAVKAALERAAVDPALVGHLVMGNVIPTETR 64 +I VVS RTAIGTF GSLK DL ++ A+ RA + P + ++GNV Sbjct: 6 DIVVVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAVNRAGLAPQDIDETIVGNVGQI-AE 64 Query: 65 DAYISRVAAMNAGIPKETPAYNVNRLCGSGLQAIINAAQTLMLGDADIVVGAGAESMSRG 124 +I+R+ + AGIP+E+ AY+VNR CGSGLQA+ + L G A++VV G E+M++ Sbjct: 65 SGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTENMTQL 124 Query: 125 PYLMPAARWGSRMGNAQVIDYMLGILHDPFHGIHMGITAENVAARNGITREMQDALAFED 184 PY + AR G RMG+ ++ D ++ IL P H GITAENVA R GITRE D A+ Sbjct: 125 PYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDFAWSS 184 Query: 185 QQRAAHAIANGYFSEQIATVEIQD-RKGVKLFSVDEHPRATSLEQLAAMKPAFKKDGSVT 243 QQ+A AIA F EQI +E+ D +K +LF+ DEHPR T E+LAA++PAFK DG VT Sbjct: 185 QQKALKAIAEERFREQILALEVPDGKKATRLFATDEHPRDTPREKLAALRPAFKADGVVT 244 Query: 244 AGNASGLNDGAAALVMASGNAVQANNLKPLARLVSYAHAGVEPEFMGLGPIPATRLALKR 303 A N+SG+NDGAAALVM + + L P R+ +A AG E MG GP PATR + R Sbjct: 245 AANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRRLMDR 304 Query: 304 AGLTVADLDVIEANIAFAAQACAVSQELDLDPAKVNPNGSGIALGHPVGATGAIIATKAI 363 + V +D+IE N AFAAQA AV +L LDPA+VN NG IALGHPVGA+GAI+ K + Sbjct: 305 LNMDVHAIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILPVKLM 364 Query: 364 HELHRTGGRYALVTMCIGGGQGIAAIFER 392 +E+ R+G R LVTMCIGGGQGI+ +FER Sbjct: 365 YEMARSGARTGLVTMCIGGGQGISMLFER 393 Lambda K H 0.318 0.133 0.378 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 396 Length adjustment: 31 Effective length of query: 362 Effective length of database: 365 Effective search space: 132130 Effective search space used: 132130 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory