Align Glycerate 3-kinase; D-Glycerate-3-kinase; Glycerate kinase 2; GK2; EC 2.7.1.31 (characterized)
to candidate BWI76_RS07025 BWI76_RS07025 glycerate kinase II
Query= SwissProt::P77364 (381 letters) >FitnessBrowser__Koxy:BWI76_RS07025 Length = 381 Score = 528 bits (1359), Expect = e-154 Identities = 269/379 (70%), Positives = 312/379 (82%) Query: 1 MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGGEGTVDAMVAATGGNI 60 MKI+I PDSFKES+SA +C QAIKAGF ++FP A +CLPIADGGEGTV+AMV AT G + Sbjct: 1 MKIIIVPDSFKESVSASRCAQAIKAGFVSIFPQAECVCLPIADGGEGTVEAMVEATDGKM 60 Query: 61 VTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKRNPLLASSFGTGELIRH 120 V L V GPMG+ V AFYGL+GDG+TA IEMAAASGLMLV +RNPL A+S+GTGELIRH Sbjct: 61 VMLPVMGPMGDFVGAFYGLSGDGQTAFIEMAAASGLMLVPAGERNPLRATSYGTGELIRH 120 Query: 121 ALDNDIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQALAANGGNLARVASIEMDECD 180 ALD +RHIILGIGGSATVDGGMGMAQALG RFLD G+++ GG L R+ I++ + D Sbjct: 121 ALDAGVRHIILGIGGSATVDGGMGMAQALGARFLDERGESVGLGGGALQRLVKIDLSDLD 180 Query: 181 PRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEELEQGLQNYARVLQQQTEIN 240 PRL +C IEVACDVDNPL+G RGAAAVFGPQKGA EMV LE+GLQNYARV+ T + Sbjct: 181 PRLHDCRIEVACDVDNPLLGERGAAAVFGPQKGACIEMVAVLERGLQNYARVMLAATGQD 240 Query: 241 VCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQAVQGAALVITGEGRIDSQTA 300 V M GGGAAGGMG AA VFLNA +K GI+IVL AV+L +A++ A LVITGEGR+DSQT Sbjct: 241 VAAMVGGGAAGGMGAAARVFLNATLKSGIDIVLEAVHLEEALRDADLVITGEGRMDSQTV 300 Query: 301 GGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDAVFSILPRLAPLAEVLASGET 360 GGKAP+GVA +AK++++PVIGIAGVLGDGVE VHQ+GIDAVFSILP LAPLAEVL GE Sbjct: 301 GGKAPVGVARIAKKYDIPVIGIAGVLGDGVEAVHQHGIDAVFSILPALAPLAEVLDRGEQ 360 Query: 361 NLFNSARNIACAIKIGQGI 379 NL+ ARNIACAIK+GQ I Sbjct: 361 NLYACARNIACAIKLGQQI 379 Lambda K H 0.318 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 551 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 381 Length adjustment: 30 Effective length of query: 351 Effective length of database: 351 Effective search space: 123201 Effective search space used: 123201 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory