Align 2-deoxy-D-ribonate 3-dehydrogenase (characterized)
to candidate BWI76_RS08900 BWI76_RS08900 putative short-chain dehydrogenase/reductase SDR
Query= reanno::BFirm:BPHYT_RS04775 (263 letters) >FitnessBrowser__Koxy:BWI76_RS08900 Length = 249 Score = 110 bits (274), Expect = 4e-29 Identities = 81/250 (32%), Positives = 135/250 (54%), Gaps = 17/250 (6%) Query: 16 LISGAAA--GIGAAIAQAFLDVGANVYICDVDPAAIDRARTAHPQLHAGVA-DVSDCAQV 72 +I+GAA+ G+G A A+ F + GA+V I D++ A A A + H G+A +V+D QV Sbjct: 9 IITGAASARGLGFATAKLFAENGASVVILDLNSEASKAAAAALGEGHLGLAANVADEVQV 68 Query: 73 DRIIDDARSKLGGLDLLINNAGIAGPTGAVEDLDPAEWERTIGTNLNSQFYFLRKAVPLL 132 ++ +K G +D+L+NNAGI P + D+ A ++ + +L + +P + Sbjct: 69 QAAMEQILAKYGRVDVLVNNAGITQPLKLM-DIKRANYDAVLDVSLRGTLLMSQAVIPTM 127 Query: 133 KETSANPGIIAMASV-AGRLGYAFRTP-YAASKWAIVGMVKSLAIELGPNNVRVNAILPG 190 + + I+ ++SV A R G F P Y+A+K ++G+ +++A ELGP+NVRVN I PG Sbjct: 128 RAQKSG-SIVCISSVSAQRGGGIFGGPHYSAAKAGVLGLARAMARELGPDNVRVNCITPG 186 Query: 191 VVEGERMDRVISARAESLGIGFDQMKGEYLQKISLRRMVTVHDVAAMALFLASPAGQNIS 250 +++ + I+A G D M L I + R+ D+A ALFL S + Sbjct: 187 LIQTD-----ITA-----GKLTDDMTANILAGIPMNRLGDAVDIARAALFLGSDLSSYST 236 Query: 251 GQAISVDGNV 260 G + V+G + Sbjct: 237 GITLDVNGGM 246 Lambda K H 0.320 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 135 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 249 Length adjustment: 24 Effective length of query: 239 Effective length of database: 225 Effective search space: 53775 Effective search space used: 53775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory