Align 1-phosphofructokinase (characterized)
to candidate BWI76_RS19730 BWI76_RS19730 1-phosphofructokinase
Query= CharProtDB::CH_024159 (312 letters) >lcl|FitnessBrowser__Koxy:BWI76_RS19730 BWI76_RS19730 1-phosphofructokinase Length = 312 Score = 606 bits (1563), Expect = e-178 Identities = 305/312 (97%), Positives = 307/312 (98%) Query: 1 MSRRVATITLNPAYDLVGFCPEIERGEVNLVKTTGLHAAGKGINVAKVLKDLGIDVTVGG 60 MSRRVATITLNPAYDLVGF PEIERGEVNLV+TTGLHAAGKGINVAKVLKDLGIDVTVGG Sbjct: 1 MSRRVATITLNPAYDLVGFTPEIERGEVNLVRTTGLHAAGKGINVAKVLKDLGIDVTVGG 60 Query: 61 FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPADWER 120 FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTP DWER Sbjct: 61 FLGKDNQDGFQQLFSELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPGDWER 120 Query: 121 FVTDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA 180 FV DSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA Sbjct: 121 FVNDSLSWLGQFDMVCVSGSLPSGVSPEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAA 180 Query: 181 PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLGAEGALWVNASGEWIA 240 PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLG EGALWVNASGEWIA Sbjct: 181 PWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGIAHVVISLGEEGALWVNASGEWIA 240 Query: 241 KPPSVDVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDRPQLA 300 KPPSV+VVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDR QLA Sbjct: 241 KPPSVEVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQSNVGITDRTQLA 300 Query: 301 AMMARVDLQPFN 312 AMMARVDLQPFN Sbjct: 301 AMMARVDLQPFN 312 Lambda K H 0.319 0.135 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 505 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 312 Length of database: 312 Length adjustment: 27 Effective length of query: 285 Effective length of database: 285 Effective search space: 81225 Effective search space used: 81225 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate BWI76_RS19730 BWI76_RS19730 (1-phosphofructokinase)
to HMM TIGR03828 (pfkB: 1-phosphofructokinase (EC 2.7.1.56))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR03828.hmm # target sequence database: /tmp/gapView.3561.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03828 [M=305] Accession: TIGR03828 Description: pfkB: 1-phosphofructokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-105 337.7 0.0 3e-105 337.5 0.0 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS19730 BWI76_RS19730 1-phosphofructokin Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS19730 BWI76_RS19730 1-phosphofructokinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 337.5 0.0 3e-105 3e-105 1 304 [. 5 308 .. 5 309 .. 0.99 Alignments for each domain: == domain 1 score: 337.5 bits; conditional E-value: 3e-105 TIGR03828 1 IlTvTlNpaiDktieleelelgevnrveserldagGKGinVarvLkklgvevvalgflGgftgeeiealle 71 ++T+TlNpa+D++ + e+e+gevn v+++ l+a+GKGinVa+vLk+lg++v++ gflG+++++ +++l++ lcl|FitnessBrowser__Koxy:BWI76_RS19730 5 VATITLNPAYDLVGFTPEIERGEVNLVRTTGLHAAGKGINVAKVLKDLGIDVTVGGFLGKDNQDGFQQLFS 75 68********************************************************************* PP TIGR03828 72 eegiktdfvevkgetRinvkikessgeetklnepGpeiseeeleallekleeqlkegdvlvlaGSlPrgvp 142 e gi+++f v+g tRinvk++e++ge+t+ n++G+e+++ ++e+++++ + l + d++ ++GSlP+gv+ lcl|FitnessBrowser__Koxy:BWI76_RS19730 76 ELGIANRFQVVQGRTRINVKLTEKDGEVTDFNFSGFEVTPGDWERFVNDSLSWLGQFDMVCVSGSLPSGVS 146 *********************************************************************** PP TIGR03828 143 edlyaelikllrekgakvilDtsgeaLlkvlkakplliKPNkeEleellgrelkteeevieaarkllekgv 213 ++++ +++ +lr++ +i+D+s eaL ++lka p+l+KPN++Ele ++gr+l + ++vieaa+ l+e+g+ lcl|FitnessBrowser__Koxy:BWI76_RS19730 147 PEAFTDWMTRLRSQCPCIIFDSSREALVAGLKAAPWLVKPNRRELEIWAGRKLPEMKDVIEAAHALREQGI 217 *********************************************************************** PP TIGR03828 214 envlislGadGallvtkegalfakapkievkstvGAGDsmvAgfllalekglsleealrlavAvgaaaass 284 ++v+islG++Gal+v+++g+++ak+p +ev+stvGAGDsmv+g++++l +s e++lrla+Av+a a+s+ lcl|FitnessBrowser__Koxy:BWI76_RS19730 218 AHVVISLGEEGALWVNASGEWIAKPPSVEVVSTVGAGDSMVGGLIYGLLMRESSEHTLRLATAVAALAVSQ 288 *********************************************************************** PP TIGR03828 285 egtelpdledieelleevki 304 ++++++d+ +++++ ++v++ lcl|FitnessBrowser__Koxy:BWI76_RS19730 289 SNVGITDRTQLAAMMARVDL 308 **************999976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (305 nodes) Target sequences: 1 (312 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.15 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory