Align The fructose/xylose:H+ symporter, PMT1 (polyol monosaccharide transporter-1). Also transports other substrates at lower rates. PMT2 is largely of the same sequence and function. Both are present in pollen and young xylem cells (Klepek et al., 2005). A similar ortholog has been identifed in pollen grains of Petunia hybrida (characterized)
to candidate BWI76_RS17580 BWI76_RS17580 MFS transporter
Query= TCDB::Q9XIH7 (511 letters) >lcl|FitnessBrowser__Koxy:BWI76_RS17580 BWI76_RS17580 MFS transporter Length = 479 Score = 204 bits (520), Expect = 4e-57 Identities = 141/479 (29%), Positives = 236/479 (49%), Gaps = 25/479 (5%) Query: 31 ILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYSLVGSGAAGRTSDWL 90 ++A+ ++ GYD GV++GA +K + L+ ++M +L I + +GS G+ +D+ Sbjct: 20 LVATFGGLLFGYDTGVINGAFSSLKQYMALTPTTEGLVMSVLLIGAALGSVFGGKFADFF 79 Query: 91 GRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVYTAEVAPASSR 150 GRR ++ FF GAL+ A + +++ RF+ G VG A + AP + +EVAP R Sbjct: 80 GRRKYLLFLSFIFFIGALMSALAPDITVLLISRFILGYAVGGASVTAPTFISEVAPTEMR 139 Query: 151 GFLTSFPEIFINIGILLGYVSNYFFSKLPEHLG--WRFMLGVGAVPSVFLAIGVLAMPES 208 G LT E+ I IG L + N L HL WR+ML V +P++ L IG+L PES Sbjct: 140 GKLTGLNEVAIVIGQLAAFAINAIIGILWGHLPDVWRYMLMVQTIPAICLFIGMLRSPES 199 Query: 209 PRWLVLQGRLGDAFKVLDKTSNTKEEAISRLDDIKRAVGIPDDMTDDVIVVPNKKSAGKG 268 PRWL+ + R +A ++L ++ ++RA +D+T + +KK + Sbjct: 200 PRWLISKNRHEEALEIL-----------KQIRPLERATKEFNDITTLIKAEADKKLHSQN 248 Query: 269 VWKDLLVRPTPSVRHILIACLGIHFAQQASGIDAVVLYSPTIFSKAGLKSKNDQLLATVA 328 + + + TP + +L+ + QQ +G++ ++ Y I S AG S+ L+ V Sbjct: 249 AF--ITILQTPWIFKLLLVGVIWAALQQTTGVNVIMYYGTEILSSAGF-SERTSLICNVL 305 Query: 329 VGVVKTLFIVVGTC-VVDRFGRRALLLTSMGGM-FLSLTALGTSLTVINRNPGQTLKWAI 386 GV ++ G +VDRF R+ +++ M L L G T++ + T W + Sbjct: 306 NGVFSVGGMLFGVLFLVDRFKRKTIIIYGFALMATLHLIIAGVDYTLVG-DIKATAIWLL 364 Query: 387 GLAVTTVMTFVATFSIGAGPVTWVYCSEIFPVRLRAQGASLGVMLNRLMSGIIGMTFLSL 446 G FV G +TWV +E+FP++ R + V +M+ I+ F L Sbjct: 365 G------AMFVGVMQGTMGFITWVVLAELFPLKFRGLSMGISVFFMWVMNAIVSYLFPLL 418 Query: 447 SKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGIPLEEMETLFGSYTANKKNNSMSKDN 505 L +G FL+FA + A VF T LPET LE++E + + N+ +K++ Sbjct: 419 QAKLGLGPVFLIFAAINYLAIVFVITALPETSNKSLEQLEEELSANKSTAGFNTATKES 477 Lambda K H 0.324 0.140 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 624 Number of extensions: 40 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 511 Length of database: 479 Length adjustment: 34 Effective length of query: 477 Effective length of database: 445 Effective search space: 212265 Effective search space used: 212265 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory