Align Sugar phosphotransferase system IIC component, component of Fructose-specific Enzyme I-HPr-Enzyme IIABC complex, all encoded within a single operon with genes in the order: ptsC (IIC), ptsA (IIA), ptsH (HPr), ptsI (Enzyme I) and ptsB (IIB) (characterized)
to candidate BWI76_RS10670 BWI76_RS10670 PTS fructose transporter subunit IIC
Query= TCDB::Q5V5X5 (383 letters) >FitnessBrowser__Koxy:BWI76_RS10670 Length = 358 Score = 243 bits (619), Expect = 8e-69 Identities = 132/343 (38%), Positives = 202/343 (58%), Gaps = 18/343 (5%) Query: 21 SVKEDLMTGVSFMIPFVTIGGIFLAVAYAIGDTQAVFENTGSAGWF-LAQIGVAGLTIMV 79 + ++ LMTGVS MIPFV GGI LAV+ + AV + L IGVAGLT+MV Sbjct: 10 NTRQHLMTGVSHMIPFVVSGGILLAVSVMLYGKGAVPDAATDPNLKKLFDIGVAGLTLMV 69 Query: 80 PILGGYIAYAIADRPGLAPGFLLAYILQQGNVVAEAATVIGISGGEAGAGYLGAIVAGLL 139 P L YI Y+I+DR LAP + A++ G GAG+ GA++AG++ Sbjct: 70 PFLAAYIGYSISDRAALAPCAIGAWV-----------------GNSFGAGFFGALIAGII 112 Query: 140 AGYVARFFKNLDVPEFIQPMMPVLLIPVATMAVLTPIMLFVLGVPVALANEGLTSFLQSM 199 G V + K + V + ++ +MP+ +IP+ + IM++ LG P+ LT +LQ M Sbjct: 113 GGLVVYYLKKIPVHKVLRSVMPIFVIPIIGTFITAGIMMWGLGEPIGALTASLTGWLQGM 172 Query: 200 QGGQAIVVGLILGGMMAFDMGGPVNKVAYVFATGLITEEIYAPMAAVMIGGMIPPIGLAL 259 + G +++ +I+G M+AFDMGGPVNKVAY F +++ +Y+ +A +G +PP+G+ L Sbjct: 173 REGSIVILAIIMGLMLAFDMGGPVNKVAYAFMLICVSQGVYSVVAIAAVGIAVPPLGMGL 232 Query: 260 SNFIAPHKYAAEMYENGKSGVVLGLSFITEGAIPYAAADPLRVIPAIVAGSAVGGATSMA 319 + I ++AE E GK+ +V+G +TEGAIP+AAADPLRVIPA + G+A G T+ Sbjct: 233 ATLIGRKYFSAEERETGKAALVMGCVGVTEGAIPFAAADPLRVIPANMIGAAAGCVTAAL 292 Query: 320 LGVTMPAPHGGIFVVLLSNQPLAFLGSILLGSLVTAVVATVIK 362 LG A GG+ V+ + F+ + +G++V+A ++K Sbjct: 293 LGAQCYAGWGGLIVLPVVEGKGGFIAGLAVGAIVSAACVILLK 335 Lambda K H 0.322 0.139 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 45 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 358 Length adjustment: 30 Effective length of query: 353 Effective length of database: 328 Effective search space: 115784 Effective search space used: 115784 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory