Align L-2,4-diketo-3-deoxyrhamnonate hydrolase; 2,4-dioxopentanoate hydrolase (characterized)
to candidate BWI76_RS03870 BWI76_RS03870 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
Query= reanno::Smeli:SM_b21112 (281 letters) >FitnessBrowser__Koxy:BWI76_RS03870 Length = 254 Score = 163 bits (413), Expect = 3e-45 Identities = 83/201 (41%), Positives = 124/201 (61%), Gaps = 7/201 (3%) Query: 71 GKFICIGLNYSDHAAETGATVPPEPIIFMKATSAIVGPNDDLVLPRGSEKTDWEVELGIV 130 G +GLNY+DHA+E T P EP++F+KA + +G + V P E +E EL +V Sbjct: 44 GTLFALGLNYADHASELAFTPPTEPLVFIKAPNTFIGHRQESVRPDNVEYMHYEAELVVV 103 Query: 131 IGKTAKYVSEAEALDYVAGYCTVHDVSERAFQTERHGQWTKGKSCDTFGPTGPWLVTKDE 190 IGKTA+ V+EA+A+ YVAGY +D + R + + + KS DT P GPW+V K+ Sbjct: 104 IGKTARKVAEADAMAYVAGYTVCNDYAIRDYLENYYRPNLRVKSRDTLTPIGPWIVGKEA 163 Query: 191 VADPQDLAMWLKVNGETMQDGSTKTMVYGAAHLVSYLSQFMSLRPGDIISTGTPPGVGMG 250 + DP +LA+ VNGE Q G+T +++ L++YLS+FM+L+PGD+I+TGTP G+ Sbjct: 164 IPDPHNLALCTWVNGELRQQGTTADLIFSIPFLIAYLSEFMTLQPGDMIATGTPKGLS-- 221 Query: 251 MKPPRYLKAGDVVELGIEGLG 271 + GD V + +EG+G Sbjct: 222 -----DVVPGDEVIVEVEGVG 237 Lambda K H 0.315 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 232 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 254 Length adjustment: 25 Effective length of query: 256 Effective length of database: 229 Effective search space: 58624 Effective search space used: 58624 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory