Align Short-chain dehydrogenase (characterized, see rationale)
to candidate BWI76_RS01745 BWI76_RS01745 sorbitol-6-phosphate 2-dehydrogenase
Query= uniprot:A0A2E7P8M8 (258 letters) >FitnessBrowser__Koxy:BWI76_RS01745 Length = 267 Score = 107 bits (266), Expect = 3e-28 Identities = 93/275 (33%), Positives = 134/275 (48%), Gaps = 40/275 (14%) Query: 3 LNLQDKVVIVTGGASGIGGAISLQLAAEGAIPVVFA-------RSEPDPQFWARLTGLQP 55 LNL++K++ VTGGASGIG AI +L A+GA + +S + FW Sbjct: 5 LNLKEKIITVTGGASGIGLAIVDELLAQGANVQMIDIHGGDKHQSSGNYNFWPT------ 58 Query: 56 RAALFQLELQDEARCGEAVAETVRRFGRLDGLVNNAGVNDSVGL-----DAGRNEFVASL 110 ++ + + V ++RFGR+DGLVNNAGVN L +GR E + Sbjct: 59 -------DISSASEVHKTVDHIIQRFGRIDGLVNNAGVNFPRLLVDEKAPSGRYELNEAA 111 Query: 111 ERNLIHY-----YVMAHYCVPHL-KATRGAILNVSSKTALTGQGNTSGYCASKGAQLSLT 164 +++ ++M+ + K G I+NVSS++ L G S Y A+K A S T Sbjct: 112 FEKMVNINQKGVFLMSQAVARQMVKQRSGVIVNVSSESGLEGSEGQSCYAATKAALNSFT 171 Query: 165 REWAAALRDDGVRVNALIP-----AEVMTPLYEKWIATFEN-PQEKLDAITSK--IPLGK 216 R W+ L G+RV + P + TP YE+ +A N E+L SK IPLG Sbjct: 172 RSWSKELGKHGIRVVGVAPGILEKTGLRTPEYEEALAWTRNITVEQLREGYSKNSIPLG- 230 Query: 217 RFTTSEEMADMAVFLLSGRSSHTTGQWVFVDGGYT 251 R E+AD +LLS R+S+ TG + GG T Sbjct: 231 RSGRLTEVADFVCYLLSERASYMTGVTTNIAGGKT 265 Lambda K H 0.318 0.134 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 146 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 267 Length adjustment: 25 Effective length of query: 233 Effective length of database: 242 Effective search space: 56386 Effective search space used: 56386 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory