Align L-fuculose phosphate aldolase (EC 4.1.2.17) (characterized)
to candidate BWI76_RS22915 BWI76_RS22915 fuculose phosphate aldolase
Query= reanno::Koxy:BWI76_RS22915 (215 letters) >FitnessBrowser__Koxy:BWI76_RS22915 Length = 215 Score = 434 bits (1117), Expect = e-127 Identities = 215/215 (100%), Positives = 215/215 (100%) Query: 1 MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEAHIVYIDA 60 MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEAHIVYIDA Sbjct: 1 MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEAHIVYIDA 60 Query: 61 EGQHEQGKLPSSEWRFHLAAYQTRPDAHAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG 120 EGQHEQGKLPSSEWRFHLAAYQTRPDAHAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG Sbjct: 61 EGQHEQGKLPSSEWRFHLAAYQTRPDAHAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG 120 Query: 121 NSIPCAPYATFGTRELSEHVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL 180 NSIPCAPYATFGTRELSEHVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL Sbjct: 121 NSIPCAPYATFGTRELSEHVAVALKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQL 180 Query: 181 YLSTLAIIDPVPVLDDEAIAVVLEKFKTYGLRIEE 215 YLSTLAIIDPVPVLDDEAIAVVLEKFKTYGLRIEE Sbjct: 181 YLSTLAIIDPVPVLDDEAIAVVLEKFKTYGLRIEE 215 Lambda K H 0.320 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 267 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 215 Length of database: 215 Length adjustment: 22 Effective length of query: 193 Effective length of database: 193 Effective search space: 37249 Effective search space used: 37249 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 45 (21.9 bits)
Align candidate BWI76_RS22915 BWI76_RS22915 (fuculose phosphate aldolase)
to HMM TIGR01086 (fucA: L-fuculose phosphate aldolase (EC 4.1.2.17))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01086.hmm # target sequence database: /tmp/gapView.7567.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01086 [M=214] Accession: TIGR01086 Description: fucA: L-fuculose phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-132 425.0 0.2 3.3e-132 424.8 0.2 1.0 1 lcl|FitnessBrowser__Koxy:BWI76_RS22915 BWI76_RS22915 fuculose phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Koxy:BWI76_RS22915 BWI76_RS22915 fuculose phosphate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 424.8 0.2 3.3e-132 3.3e-132 1 214 [] 2 215 .] 2 215 .] 1.00 Alignments for each domain: == domain 1 score: 424.8 bits; conditional E-value: 3.3e-132 TIGR01086 1 nraelsqkiidtclemtrlglnqgtagnvsvrykdgmlitptgipyeklteehivyvdgngkfeegklpss 71 +r++l+++iidtclemtrlglnqgtagnvsvry+ gmlitptgipyeklte hivy+d +g++e+gklpss lcl|FitnessBrowser__Koxy:BWI76_RS22915 2 ERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGMLITPTGIPYEKLTEAHIVYIDAEGQHEQGKLPSS 72 69********************************************************************* PP TIGR01086 72 ewrfhlavyqsrpdanavvhnhaihcaavsilnksipaihymvaasgadeipcvpyatfgsrklaeyvaeg 142 ewrfhla+yq+rpda avvhnha+hc+avsiln++ipaihym+aa+g+++ipc+pyatfg+r+l+e+va + lcl|FitnessBrowser__Koxy:BWI76_RS22915 73 EWRFHLAAYQTRPDAHAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVAVA 143 *********************************************************************** PP TIGR01086 143 ikeskaillqhhgliacevnlekalwlahevevladlylktlaitdevpvlseeelavvlekfktyglrie 213 +k++ka+llqhhgliace+nlekalwlahevevla+lyl tlai d+vpvl++e +avvlekfktyglrie lcl|FitnessBrowser__Koxy:BWI76_RS22915 144 LKNRKATLLQHHGLIACEENLEKALWLAHEVEVLAQLYLSTLAIIDPVPVLDDEAIAVVLEKFKTYGLRIE 214 **********************************************************************9 PP TIGR01086 214 e 214 e lcl|FitnessBrowser__Koxy:BWI76_RS22915 215 E 215 7 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (214 nodes) Target sequences: 1 (215 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory