Align L-fuconate dehydratase; FucD; EC 4.2.1.68 (characterized)
to candidate BWI76_RS13570 BWI76_RS13570 mandelate racemase/muconate lactonizing protein
Query= SwissProt::Q8P3K2 (441 letters) >FitnessBrowser__Koxy:BWI76_RS13570 Length = 398 Score = 111 bits (277), Expect = 5e-29 Identities = 96/345 (27%), Positives = 146/345 (42%), Gaps = 67/345 (19%) Query: 30 PDYSAAYVVLRTDGAEDLAGYGLVFTIGRGNDVQTAAVAALAEHVVGLS---VDKVIADL 86 P A ++ + G G ++ G A +A++++G +DK+ Sbjct: 56 PLTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIY--- 112 Query: 87 GAFARRLTNDSQLRWLGPEKGVMHMAIGAVIN---AAWDLAARAANKPLWRFIAELTPEQ 143 ++L W G G MA+ A+ A WD+ A+ A PL + + Sbjct: 113 ----------TKLLWAGASVGRSGMAVQAISPLDIALWDMKAKRAGLPLAKLLGS----- 157 Query: 144 LVDTIDFRYLSDALTRDEALAILRDAQPQRAARTATLIEQGYPAYTTSPGWLGYSDEKLV 203 RD Y TS G+L ++++ Sbjct: 158 --------------HRDSV-----------------------QCYNTSGGFLHTPLDQVL 180 Query: 204 RLAKEAVADGFRTIKLKVGA-NVQDDIRRCRLARAAIGPDIAMAVDANQRWDVGPAIDWM 262 + + +G IKLKVG N +DIRR R +G D + VDANQ+WD AI Sbjct: 181 KNVAISRENGIGGIKLKVGQPNTAEDIRRLTAVREVLGDDFPLMVDANQQWDRETAIRMG 240 Query: 263 RQLAEFDIAWIEEPTSPDDVLGHAAIRQGITPVPVSTGEHTQNRVVFKQLLQAGAVDLIQ 322 R++ F++ WIEEP DV GHA + + P++TGE + +QL+ A D +Q Sbjct: 241 RKMEPFNLIWIEEPLDAYDVEGHAQLAAAL-DTPIATGEMLTSFREHEQLILGNASDFVQ 299 Query: 323 IDAARVGGVNENLAILLLAAKFGVRVFPHAGGVGLCELVQHLAMA 367 DA RVGG++ L I+ LAAK G ++ PH E+ HLA A Sbjct: 300 PDAPRVGGISPFLKIMDLAAKHGRKLAPHFA----MEVHLHLAAA 340 Lambda K H 0.321 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 29 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 441 Length of database: 398 Length adjustment: 32 Effective length of query: 409 Effective length of database: 366 Effective search space: 149694 Effective search space used: 149694 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory