Align L-fuculose kinase (characterized, see rationale)
to candidate BWI76_RS00680 BWI76_RS00680 rhamnulokinase
Query= uniprot:G8JZS7 (476 letters) >FitnessBrowser__Koxy:BWI76_RS00680 Length = 488 Score = 322 bits (825), Expect = 2e-92 Identities = 186/467 (39%), Positives = 258/467 (55%), Gaps = 10/467 (2%) Query: 10 LAVDFGGGSGRVIAGSLLQGK--LELEEIHRFTNRQVKLGNHVYWDFPALFEDMKTGLKL 67 +AVD G SGRV+ S G+ L L EIHRFTN K+ WD +L +++ GL+ Sbjct: 7 VAVDLGASSGRVMLASYQPGQQTLALREIHRFTNSLQKVDGFDCWDLDSLEGEIRRGLEK 66 Query: 68 AAQKGYHVKGIGIDTWGVDFGLIDKKGNLLGNPVCYRDARTDGMPDKVFQILDAQKHYAC 127 ++G + IGIDTWGVD+ L+DK+G +G PV YRD+RT G+ L + Y Sbjct: 67 VCEQGILIDSIGIDTWGVDYVLLDKRGQRVGLPVSYRDSRTQGLMRHAEAQLGRAEIYRR 126 Query: 128 TGIQVMPINTLFQLYSMQQNQDVLLEVAQRLLFMPDLFSYYLTGVANNEYCIASTSELLD 187 +GIQ +P NTL+QL ++ + Q L+ A L +PD FS+ LTG N EY A+T++L++ Sbjct: 127 SGIQFLPFNTLYQLRALVEQQPELVSQAAHALLIPDYFSFRLTGNMNWEYTNATTTQLVN 186 Query: 188 ARQRNWSMDTIRALGLPEHLFGEIILPGTVRGTLKEEIGRETGLGPVDIIAVGSHDTASA 247 +W D + G P FG PG V G G + ++AV SHDTASA Sbjct: 187 INSDSWDEDLLNWSGAPREWFGTPTHPGNVIGHWICPQGNH-----IPVVAVASHDTASA 241 Query: 248 VAAVPATEGQVAFLSSGTWSLLGVEVDEPILTEEARLAQFTNEGGVGGHIRFLQNITGLW 307 V A P A+LSSGTWSL+G E P ++ A A TNEGG G R L+NI GLW Sbjct: 242 VIASPLASKNAAYLSSGTWSLMGFESKIPCTSDAALRANITNEGGAEGRYRVLKNIMGLW 301 Query: 308 ILQRLMSEWKLRGEEQSYDTILPQAADAEIDTIIPVDDAEFMNPENMETALLNYCRNHSL 367 +LQR++ E + I AA +I +D F+NP++M + CR Sbjct: 302 LLQRVLRE---QNVSDLPALIARTAALPACRFVIDCNDDRFINPDDMSAEIQAACRESGQ 358 Query: 368 KVPGNKAEMVKCVLQSLAFKYREAVAQLNRCLPSPIHRLNIIGGGSQNKLLNQLTANALG 427 VP AE+ +C+ SLA Y + +L P +L+I+GGG QN+LLNQL A+A G Sbjct: 359 PVPDTDAELARCIFDSLALLYTRVLNELAALRGQPFSQLHIVGGGCQNELLNQLCADACG 418 Query: 428 IPVYAGPVEATAMGNILTQAMAKGEISSLREIREVVSHSVTPQVYYP 474 I V AGPVEA+ +GNI Q M E++++ E R+VV + + P Sbjct: 419 ITVVAGPVEASTLGNIGIQLMTLDELNNVDEFRQVVRQNYALTTFTP 465 Lambda K H 0.319 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 591 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 488 Length adjustment: 34 Effective length of query: 442 Effective length of database: 454 Effective search space: 200668 Effective search space used: 200668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory