GapMind for catabolism of small carbon sources

 

Aligments for a candidate for BPHYT_RS16930 in Klebsiella michiganensis M5al

Align Arabinose import ATP-binding protein AraG; EC 7.5.2.12 (characterized, see rationale)
to candidate BWI76_RS19640 BWI76_RS19640 galactose/methyl galactoside ABC transporter ATP-binding protein MglA

Query= uniprot:B2SYR5
         (512 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS19640 BWI76_RS19640
           galactose/methyl galactoside ABC transporter ATP-binding
           protein MglA
          Length = 506

 Score =  389 bits (1000), Expect = e-112
 Identities = 211/494 (42%), Positives = 310/494 (62%), Gaps = 10/494 (2%)

Query: 5   LRFDNIGKVFPGVRALDGVSFDVNVGQVHGLMGENGAGKSTLLKILGGEYQPDSGRVMID 64
           L   NI K FPGV+ALD V+  V    +H LMGENGAGKSTLLK L G YQ DSG ++  
Sbjct: 14  LEMTNINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGSILFQ 73

Query: 65  GNEVRFTSAASSIAAGIAVIHQELQYVPDLTVAENLLLGQLPNSLGWVNKREAKRFVRER 124
           G E+ F SA  ++  GI+++HQEL  V   +V +N+ LG+ P    +V++ +  R  +  
Sbjct: 74  GQEIDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGVFVDQDKMYRDTKAI 133

Query: 125 LEAMGVALDPNAKLRKLSIAQRQMVEICKALLRNARVIALDEPTSSLSHRETEVLFKLVR 184
            + + + +DP A++  LS++Q QM+EI KA   NA+++ +DEPTSSL+ +E   LFK++R
Sbjct: 134 FDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFKIIR 193

Query: 185 DLRADNRAMIYISHRMDEIYELCDACTIFRDGRKIASHPTLEGVTRDTIVSEMVGREISD 244
            L+     ++YISH+M+EI++LCD  TI RDG+ IA+ P LEG+  D I++ MVGR ++ 
Sbjct: 194 KLKERGCGIVYISHKMEEIFQLCDEITILRDGQWIATQP-LEGLDMDKIIAMMVGRSLNQ 252

Query: 245 IYNYSARPLGEVRFAAKGIEGHALAQPA----SFEVRRGEIVGFFGLVGAGRSELMHLVY 300
            +       GEV    + +   +L QP+    SF++ +GEI+G  GLVGA R++++  ++
Sbjct: 253 RFPNKENKPGEVILEVRNLT--SLRQPSIRDISFDLHKGEILGIAGLVGAKRTDIVETLF 310

Query: 301 GADHKKGGELLLDGKPIKVRSAGEAIRHGIVLCPEDRKEEGIVAMATVSENINISCRRHY 360
           G   K GG + L GK I   SA EAI HG  L  E+R+  GI A   +  N  IS  + Y
Sbjct: 311 GIREKAGGTIRLHGKKINNHSANEAINHGFALVTEERRSTGIYAYLDIGFNSLISNIKKY 370

Query: 361 LRVGMFLDRKKEAETADRFIKLLKIKTPSRRQKIRFLSGGNQQKAILSRW-LAEPDLKVV 419
                 LD  +        I  +++KTP +  +I  LSGGNQQK I+ RW L +P+  ++
Sbjct: 371 KNKVGLLDNSRMKSDTQWVIDSMRVKTPGQHTQIGSLSGGNQQKVIIGRWLLTQPE--IL 428

Query: 420 ILDEPTRGIDVGAKHEIYNVIYQLAERGCAIVMISSELPEVLGVSDRIVVMRQGRISGEL 479
           +LDEPTRGIDVGAK EIY +I +LA++   I++ISSE+PE+LG++DRI+VM  G ++G +
Sbjct: 429 MLDEPTRGIDVGAKFEIYQLIAELAKKDKGIIIISSEMPELLGITDRILVMSNGLVAGIV 488

Query: 480 TRKDATEQSVLSLA 493
             K  T+  +L LA
Sbjct: 489 ETKTTTQNEILRLA 502



 Score = 85.9 bits (211), Expect = 3e-21
 Identities = 64/233 (27%), Positives = 109/233 (46%), Gaps = 8/233 (3%)

Query: 242 ISDIYNYSARPLGEVRFAAKGIEGHALAQPASFEVRRGEIVGFFGLVGAGRSELMHLVYG 301
           +S+    S   L E+    K   G       + +VR   I    G  GAG+S L+  ++G
Sbjct: 2   VSNNSERSGEYLLEMTNINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFG 61

Query: 302 ADHKKGGELLLDGKPIKVRSAGEAIRHGIVLCPEDRKEEGIVAMATVSENINISCRRHYL 361
              K  G +L  G+ I   SA EA+ +GI +     +E  +V   +V +N+ +     Y 
Sbjct: 62  IYQKDSGSILFQGQEIDFHSAKEALENGISMV---HQELNLVLQRSVMDNMWLG---RYP 115

Query: 362 RVGMFLDRKKEAETADRFIKLLKIKTPSRRQKIRFLSGGNQQKAILSRWLAEPDLKVVIL 421
             G+F+D+ K           L I     R ++  LS    Q   +++  +  + K+VI+
Sbjct: 116 TKGVFVDQDKMYRDTKAIFDELDIDI-DPRARVGTLSVSQMQMIEIAKAFSY-NAKIVIM 173

Query: 422 DEPTRGIDVGAKHEIYNVIYQLAERGCAIVMISSELPEVLGVSDRIVVMRQGR 474
           DEPT  +     + ++ +I +L ERGC IV IS ++ E+  + D I ++R G+
Sbjct: 174 DEPTSSLTEKEVNHLFKIIRKLKERGCGIVYISHKMEEIFQLCDEITILRDGQ 226


Lambda     K      H
   0.320    0.136    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 590
Number of extensions: 24
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 512
Length of database: 506
Length adjustment: 34
Effective length of query: 478
Effective length of database: 472
Effective search space:   225616
Effective search space used:   225616
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory