Align UDP-glucose 4-epimerase (EC 5.1.3.2); UDP-N-acetylglucosamine 4-epimerase (EC 5.1.3.7) (characterized)
to candidate BWI76_RS27260 BWI76_RS27260 ADP-L-glycero-D-mannoheptose-6-epimerase
Query= BRENDA::Q9WYX9 (309 letters) >FitnessBrowser__Koxy:BWI76_RS27260 Length = 310 Score = 95.9 bits (237), Expect = 1e-24 Identities = 77/247 (31%), Positives = 120/247 (48%), Gaps = 18/247 (7%) Query: 3 ILVTGGAGFIGSHVVDKLIENGY-GVIVVDNLSSGKVENLNRNALFYEQSIEDEEMMERI 61 I+VTGGAGFIGS++V L + G ++VVDNL G + +N L ++ E+ + +I Sbjct: 2 IIVTGGAGFIGSNIVKALNDQGITDILVVDNLKDG-TKFINLVDLNIADYMDKEDFLIQI 60 Query: 62 FSLHR---PEYVFHLAAQASVAISVREPARDAKTNIIGSLVLLEKSIKYGVKK---FIFS 115 + + +FH A +S D K + + ++ + Y +++ F+++ Sbjct: 61 MAGEEFGDIDAIFHEGACSSTT------EWDGKYMMDNNYQYSKEVLHYCLEREIPFLYA 114 Query: 116 STGGAIYGENVKVFPTPETEIPHPISPYGIAKYSTEMYLEFFAREYGLKYTVLRYANVYG 175 S+ A YG F E P++ YG +K+ + Y+ E + RY NVYG Sbjct: 115 SSA-ATYGGRTSDF-IESREYEQPLNVYGYSKFLFDEYVRQILPEANSQIVGFRYFNVYG 172 Query: 176 PRQDPYGEAGVVAIFTERMLR-GEEVHIF-GDGEYVRDYVYVDDVVRANLLAMEKGDNEV 233 PR+ G VA L GE +F G + RD+VYV DV NL E G + + Sbjct: 173 PREGHKGSMASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVAAVNLWFWENGVSGI 232 Query: 234 FNIGTGR 240 FN+GTGR Sbjct: 233 FNLGTGR 239 Lambda K H 0.318 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 263 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 309 Length of database: 310 Length adjustment: 27 Effective length of query: 282 Effective length of database: 283 Effective search space: 79806 Effective search space used: 79806 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory