Align L-arabinonolactonase (characterized, see rationale)
to candidate BWI76_RS23720 BWI76_RS23720 calcium-binding protein
Query= uniprot:A0A1I2AUG6 (300 letters) >FitnessBrowser__Koxy:BWI76_RS23720 Length = 292 Score = 168 bits (426), Expect = 1e-46 Identities = 112/286 (39%), Positives = 150/286 (52%), Gaps = 13/286 (4%) Query: 13 LGEGILWCEREQALYWTDIQAATLWRHRPADGATRSWEMPERLGCLALCEADGWLLLGLA 72 LGE +W +Q L+W D L+ GA +SW++ +++G AL + ++ L Sbjct: 13 LGESPVWDIEQQRLWWVDSLDGRLFACNAQGGAIKSWDVRQKIGSFALRQNGEGAVVALQ 72 Query: 73 TRLAFFRPEDDLLLPLVSVEPDLP-TRLNDGACDRQGRFVFGTLHEPAAGETRQPIGAFY 131 + L L E D P RLNDG DRQGRF+FG++ +P GA Y Sbjct: 73 NGVHLLDFASGGLTLLHHPEADRPFNRLNDGKVDRQGRFLFGSMDM----REEEPSGALY 128 Query: 132 RLNADLTLERLNLPGIGISNSVAFSPDGRTMYFCDSPSRVIQCCDY----GDRCGEPRVF 187 RL+ADL+L L I +SN+ +SP G T YF D+ + I DY GD GE RVF Sbjct: 129 RLDADLSLHVLK-KNIIVSNAPCWSPSGETFYFADTWTGEICAWDYNTATGDLSGE-RVF 186 Query: 188 ARVD-DERGEPDGSAVDAQGCLWNAQWGLGRVVRYAPDGRVDRIVEVPATQPTRPAFGDS 246 VD E G DG+ VD++G LWNA G++VRY P+G VDRI+E+P + T FG Sbjct: 187 CHVDRSEGGAADGATVDSEGYLWNALVYAGKLVRYTPEGEVDRIIEMPVKKVTSVMFGGE 246 Query: 247 PLDTLYITSARDGLSSAALATQPLAGALFAA-DAGASGLPEPRFRG 291 LD LY+TS L G+LFA D G +G+ E RF G Sbjct: 247 NLDVLYVTSMAQPPLPRFPEDNQLRGSLFAIYDLGVTGVAERRFAG 292 Lambda K H 0.321 0.139 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 297 Number of extensions: 24 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 292 Length adjustment: 26 Effective length of query: 274 Effective length of database: 266 Effective search space: 72884 Effective search space used: 72884 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory