Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate BWI76_RS07640 BWI76_RS07640 short chain dehydrogenase
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2119 (272 letters) >FitnessBrowser__Koxy:BWI76_RS07640 Length = 261 Score = 135 bits (340), Expect = 9e-37 Identities = 91/255 (35%), Positives = 131/255 (51%), Gaps = 18/255 (7%) Query: 19 LKNKVVLLTGAAQGIGEAIVATFASQQARLIISDIQ-----GEKVEKVAAHWRDQGADVV 73 L+++V +TGA GIG+ I AS AR++ D++ E V+ + A G + Sbjct: 13 LQDRVAFVTGAGSGIGQMIAYGLASAGARVVCFDLREDGGLAETVKNIEAI----GGEAC 68 Query: 74 AIKADVSRQQDLHAMARLAIDLHGRIDVLVNCAGVNVFRDPLEMTEEDWRRCFAIDLDGA 133 DV + DL A LA GR+D+ VN AG+ LEM E W+R I+L G Sbjct: 69 FYTGDVRQLSDLRAGVALAKSRFGRLDIAVNAAGIANANPALEMETEQWQRVIDINLTGV 128 Query: 134 WYGCKAVLPQMIEQGIGSIINIASTHSTHIIPGC--FPYPVAKHGLLGLTRALGIEYAPK 191 W CKA M E G GSIINIAS + G Y +K G++ L+++L +E+ K Sbjct: 129 WNSCKAEAELMQETGGGSIINIASMSGIIVNRGLDQAHYNCSKAGVIHLSKSLAMEWIGK 188 Query: 192 GVRVNAIAPGYIETQLNVDYWNGFADPHAERQRAFDLHPP-RRIGQPIEVAMTAVFLASD 250 G+RVN+I+PGY T +N + R F+ P +R+ + E+A A+FLASD Sbjct: 189 GIRVNSISPGYTATPMNT------RPEMVHQTREFESQTPIQRMAKVEEMAGPALFLASD 242 Query: 251 EAPFINASCITIDGG 265 A F + +DGG Sbjct: 243 AASFCTGVDLVVDGG 257 Lambda K H 0.322 0.138 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 145 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 261 Length adjustment: 25 Effective length of query: 247 Effective length of database: 236 Effective search space: 58292 Effective search space used: 58292 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory