Align MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized)
to candidate BWI76_RS07245 BWI76_RS07245 ABC transporter
Query= TCDB::P23200 (336 letters) >FitnessBrowser__Koxy:BWI76_RS07245 Length = 343 Score = 215 bits (547), Expect = 1e-60 Identities = 126/328 (38%), Positives = 192/328 (58%), Gaps = 18/328 (5%) Query: 14 KEGGIYVVLLVL-----LAIIIFQDPTFLSLLN-LSNILTQSSVRIIIALGVAGLIVTQG 67 K+ GI++V+LV+ +A +D +FL N L I+ Q ++ IIA+GV +I+T G Sbjct: 27 KDTGIFIVMLVIALTFEIAGWYVRDQSFLLNTNRLILIVLQVAIIGIIAVGVTQVIITTG 86 Query: 68 TDLSAGRQVGLAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIGLINGLII 127 DLS+G + LAAVVAA+L Q+ D+ + +FP + MP + I +G + GL NG ++ Sbjct: 87 IDLSSGSVIALAAVVAASLAQTSDSLSPMFPSLVNMPAIIPIGAGIGVGLLCGLTNGFLV 146 Query: 128 AYLNVTPFITTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGSFRLSYIT 187 + PFI TLG M+ G+ Y +PIS F+ QG + + I Sbjct: 147 TRTGIPPFIATLGMMVSARGLAQYYTQ---GNPISFLSDSFTAIGQGAMPV-------II 196 Query: 188 FYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGVFYAFGGM 247 F+ + AV + + TR+GK ++AIGGN +AKVSG+NV L+++YA++G G+ Sbjct: 197 FFVVAAVFHIAL--KHTRYGKYVYAIGGNMTSAKVSGINVNKYLVIVYAIAGALSGLAGV 254 Query: 248 LEAGRIGSATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVINYGLTYIG 307 + A R+ S +++G YELDAIAA V+GG S GGVG + G + G +I +I G T++G Sbjct: 255 VLAARVSSGQSSMGMSYELDAIAAAVIGGSSLMGGVGRITGTLIGAMILGLIKSGFTFVG 314 Query: 308 VNPYWQYIIKGAIIIFAVALDSLKYARK 335 V+ Y Q IIKG II+ AV +D + +K Sbjct: 315 VDAYVQDIIKGIIIVAAVTIDMRRNRKK 342 Lambda K H 0.327 0.143 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 349 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 343 Length adjustment: 28 Effective length of query: 308 Effective length of database: 315 Effective search space: 97020 Effective search space used: 97020 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory