Align PTS system galactose-specific EIIC component (characterized)
to candidate BWI76_RS22395 BWI76_RS22395 hypothetical protein
Query= SwissProt::A2RJV0 (451 letters) >FitnessBrowser__Koxy:BWI76_RS22395 Length = 423 Score = 132 bits (333), Expect = 2e-35 Identities = 120/448 (26%), Positives = 199/448 (44%), Gaps = 52/448 (11%) Query: 8 LNKTLMPLASKMNKNHFISALSEAFMRCMPLTLGIALLTIIGYFPVPAWVDFLNSIG--- 64 + + L PLA+ + +N+ I+A+ ++F MP + +LL I + PV +D + G Sbjct: 13 IEQRLAPLANVLTRNNHITAMRDSFALAMPFVIVGSLLVPILFPPVS--IDGASFFGQFY 70 Query: 65 ------LAQHFSAVIGAVTSALAIYVTYNFAYSYVNRHEYNGHTAGLLSIASLLMLMPQI 118 L F IG V A+ V + + S ++ GL + L+ + Sbjct: 71 FQLRPILLPTFELTIGLV----ALIVAFGASASLAKQYRLPERLCGLTGCLAFLLFIG-- 124 Query: 119 ITVPVVKNIPTEFPKSAVVDSVSNVEAFQTVYTGSTGLIVAIIIGFIVSLVYIQLSKRNL 178 F + + +Y G G+ A+I + K+ Sbjct: 125 ------------FRGNGAAN----------LYLGGMGIFTALISSTYSIEIVRFFYKKGW 162 Query: 179 VIKLPAGVPPMVVDSLSPAIISMVIFCLMFGIRVGFSYTPFHDIFNFSTQLIQAPLTGAV 238 I+LP VP M + I +V+ + I + + ++ ++ + + Sbjct: 163 CIRLPEEVPVMTRNGFQLLIPLLVVMLSISVINALLLQSTGRILPELISEAVRPLVVASD 222 Query: 239 ANPWVLMGIFTFGNFLWFFGIHPNLI-GGILNPLLLTMSYANIDAYAAGK---PVPYLQM 294 VL+ +F N LWF GIH LI GI+NP +T + N A AAG P YLQ Sbjct: 223 TLTAVLISLFIC-NLLWFVGIHGALIITGIMNPFWMTYLFENQQALAAGSATLPHIYLQG 281 Query: 295 MIVFAVGANAWGGSGNTYGLVISMFTAKSERYKQLLKLGAIPSIFNISEPLLFGLPMMLN 354 F + GG G+T LV ++S + K + K+G +PS+FNI+EP+LFG P+++N Sbjct: 282 FWDFYL---LIGGIGSTLPLVFMAMRSRSRQLKSVGKIGLLPSLFNINEPILFGFPIIMN 338 Query: 355 PLFFIPLVFQPAILGTVALGLAKILYITNLNPMTALLPWTTPAPVRMAIS--GGLPFLII 412 P+F +P +F P I +A L + + L+ A+LPW+ PAP+ A S G L + Sbjct: 339 PVFLLPFLFVPLINACIAWYLTQ---LGILDRAVAMLPWSMPAPLGAAWSANGSWKNLCM 395 Query: 413 FAICLVLNVLIYYPFFKVAYNKALEEEK 440 + ++Y PFFKV + + E+ Sbjct: 396 CLFAIFNAWMLYRPFFKVYERQLADAER 423 Lambda K H 0.327 0.142 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 512 Number of extensions: 30 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 451 Length of database: 423 Length adjustment: 32 Effective length of query: 419 Effective length of database: 391 Effective search space: 163829 Effective search space used: 163829 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory