GapMind for catabolism of small carbon sources

 

Aligments for a candidate for PS417_04205 in Klebsiella michiganensis M5al

Align D-galacturonate transporter (MFS superfamily) (characterized)
to candidate BWI76_RS16940 BWI76_RS16940 MFS transporter

Query= reanno::WCS417:GFF828
         (454 letters)



>lcl|FitnessBrowser__Koxy:BWI76_RS16940 BWI76_RS16940 MFS
           transporter
          Length = 439

 Score =  372 bits (955), Expect = e-107
 Identities = 184/434 (42%), Positives = 270/434 (62%), Gaps = 12/434 (2%)

Query: 5   KPTHVRYLILLMLFLVTTINYADRATIAIAGSSLQKDLGIDAVTLGYIFSAFGWAYVAGQ 64
           +P+  R  IL +L + T INY DR  + IA   L  +LGIDA  +G +FSAF W Y   Q
Sbjct: 18  RPSRRRIGILALLAVGTMINYLDRTVLGIAAPQLTAELGIDAAMMGIVFSAFAWTYALAQ 77

Query: 65  IPGGWLLDRFGSKKVYALSIFTWSLFTVLQGYVGEFGVSTAVVALFMLRFMVGLAEAPSF 124
           IPGG  LDRFG+K  Y L++  WSLFT+  G      ++  + +L + RF +G++EAP F
Sbjct: 78  IPGGIFLDRFGNKVTYFLALTLWSLFTLFHG------MAVGLKSLLLCRFGLGVSEAPCF 131

Query: 125 PGNARIVAAWFPTAERGTASAIFNSAQYFATVLFAPLMGWIVYSFGWQHVFIVMGVIGII 184
           P N+R+V+AWFP  ER  A+A++   +Y     FAPL+ WI+ SFGW+ +FI +G  G++
Sbjct: 132 PVNSRVVSAWFPQQERAKATAVYTVGEYLGLACFAPLLFWIMGSFGWRALFISVGAAGVL 191

Query: 185 FSLIWLKVIHSPRQHPMINEAEFNHIAANGAMVDMDQDKGKGKKTDGPKWDYIRQLLTNR 244
           F+L+W +    P +   +N+ E  HI   G M       G  + T    W  +RQLL  R
Sbjct: 192 FALVWWRCYREPHEDKHLNQLEREHIINGGGM-----STGAEQHT-AFSWPLVRQLLAKR 245

Query: 245 MMLGVYLGQYCINGITYFFLTWFPVYLVQDRGMTILKAGFIASLPAICGFIGGVLGGVIS 304
            +LG  +GQ+  N +  FFLTWFP YL  +R M  +K GF A +P +    G + GG +S
Sbjct: 246 QILGASIGQFAGNTVLVFFLTWFPTYLATERHMPWIKVGFFAIMPFLAAAGGVMFGGWVS 305

Query: 305 DYLLRKGHSLTFARKAPIIGGLLISSSIVACNYVDIEWMVVGFMALAFFGKGVGALGWAV 364
           D LL+   S    RK PII GLL++S+I+A N++  +  V+  M+ AFFG+G+  LGW +
Sbjct: 306 DKLLKATGSANLGRKLPIIAGLLMASTIIAANWLTSDLAVILVMSFAFFGQGMVGLGWTL 365

Query: 365 VSDTSPKQIAGLSGGLFNTFGNLASITTPIVIGYIISTTGSFKWALVFVGANALVAVFSY 424
           +SD +PK + GL+GGLFN   NLA I TP++IG+I++ +G+F +AL+++G  AL+ V +Y
Sbjct: 366 ISDIAPKGLGGLTGGLFNFCANLAGILTPLIIGFIVAASGNFFYALIYIGGAALLGVAAY 425

Query: 425 LVIVGPIKRVVLKE 438
           L I+G +KR+ L +
Sbjct: 426 LFILGDVKRIELSQ 439


Lambda     K      H
   0.327    0.142    0.444 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 654
Number of extensions: 39
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 454
Length of database: 439
Length adjustment: 33
Effective length of query: 421
Effective length of database: 406
Effective search space:   170926
Effective search space used:   170926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory