Align Phthalate permease of the major facilitator superfamily protein (characterized, see rationale)
to candidate BWI76_RS16940 BWI76_RS16940 MFS transporter
Query= uniprot:D8IX31 (418 letters) >FitnessBrowser__Koxy:BWI76_RS16940 Length = 439 Score = 177 bits (450), Expect = 4e-49 Identities = 116/384 (30%), Positives = 179/384 (46%), Gaps = 11/384 (2%) Query: 11 MVTLVTLALIVNYLARNTLSVAAPTMMKELDMSTQQYSYIVVAWQICYAVMQPVAGYILD 70 ++ L+ + ++NYL R L +AAP + EL + + A+ YA+ Q G LD Sbjct: 26 ILALLAVGTMINYLDRTVLGIAAPQLTAELGIDAAMMGIVFSAFAWTYALAQIPGGIFLD 85 Query: 71 AVGTKIGFGIFALAWSLVCAAAAFATGWQSLAFFRALLGITEAAGIPGGVKASTEWFPAK 130 G K+ + + WSL A G +SL R LG++EA P + + WFP + Sbjct: 86 RFGNKVTYFLALTLWSLFTLFHGMAVGLKSLLLCRFGLGVSEAPCFPVNSRVVSAWFPQQ 145 Query: 131 ERSVAIGWFNIGSSIGALCAPPLVVWTILHGGWKMSFVVVGALGVIWFVLWMLFYKSPRD 190 ER+ A + +G +G C PL+ W + GW+ F+ VGA GV++ ++W Y+ P + Sbjct: 146 ERAKATAVYTVGEYLGLACFAPLLFWIMGSFGWRALFISVGAAGVLFALVWWRCYREPHE 205 Query: 191 QKLLSPEERAYILEGQEKSPEKVQRE--SW---TKIVRSRNFWSIAIPRFLSEPAWQTFN 245 K L+ ER +I+ G S Q SW +++ R +I +F F Sbjct: 206 DKHLNQLEREHIINGGGMSTGAEQHTAFSWPLVRQLLAKRQILGASIGQFAGNTVLVFFL 265 Query: 246 AWIPLYMATERHMNIKEIAMFAWLPFLAADIGCVLGGYLSPLFHKHLKV--SLFTSRKLV 303 W P Y+ATERHM ++ FA +PFLAA G + GG++S K LK S RKL Sbjct: 266 TWFPTYLATERHMPWIKVGFFAIMPFLAAAGGVMFGGWVS---DKLLKATGSANLGRKLP 322 Query: 304 MLVGSLSMIGPACVGFVDSPYVAIALLSIGGFAHQTLSGALYSITSDVFTKNQVATATGL 363 ++ G L ++ S I ++S F Q + G +++ SD+ K GL Sbjct: 323 IIAGLLMASTIIAANWLTSDLAVILVMSFAFFG-QGMVGLGWTLISDIAPKGLGGLTGGL 381 Query: 364 TGMSGYLGATLFTLLFGILVTQIG 387 L L L+ G +V G Sbjct: 382 FNFCANLAGILTPLIIGFIVAASG 405 Lambda K H 0.327 0.138 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 567 Number of extensions: 27 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 439 Length adjustment: 32 Effective length of query: 386 Effective length of database: 407 Effective search space: 157102 Effective search space used: 157102 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory