Align L-talarate dehydratase (EC 4.2.1.156); galactarate dehydratase (EC 4.2.1.42) (characterized)
to candidate BWI76_RS03435 BWI76_RS03435 mandelate racemase/muconate lactonizing protein
Query= BRENDA::Q8ZL58 (398 letters) >FitnessBrowser__Koxy:BWI76_RS03435 Length = 367 Score = 176 bits (445), Expect = 1e-48 Identities = 112/328 (34%), Positives = 172/328 (52%), Gaps = 7/328 (2%) Query: 57 LTEVAIIIAEIRSRDGFEGVGFSYSKRAGGQGIYAHAKEIADNLLGEDPNDIDKIYTKLL 116 +T++ + I ++ +G G GFS++ G+ I A EI +++G+ P ++ + Sbjct: 33 VTDIEVAIVDVYGSNGHVGTGFSHTSGWCGKTISALIAEIIPDVIGQ-PLSPRGLWHRSY 91 Query: 117 WAGASVGRSGMAVQAISPIDIALWDMKAKRAGLPLAKLLGAHRDSVQCYNTSGGFLHTPL 176 VG +G+ A++ +DIA WD+ K P+ +LG RD V Y SG LH + Sbjct: 92 KHVHDVGGAGVTTHALAALDIAYWDLLGKTLNAPIIDILGRVRDRVPLYG-SGINLHLSI 150 Query: 177 DQVLKNVVISRENGIGGIKLKVGQPNCAEDIRRLTAVREALGDEFPLMVDANQQWDRETA 236 ++V+ V + G K+KVG+P ED+ RL ++EA+ FPL VDANQ W+ A Sbjct: 151 EEVIDQVKRWKSTGYLAAKVKVGKPTLEEDVERLRKIQEAVPG-FPLAVDANQGWNFPQA 209 Query: 237 IRMGRKMEQFNLIWIEEPLDAYDIEGHAQLAAALDTPIATGEMLTSFREHEQLILGNASD 296 +R + E NL+WIEEP+ + DI GH +L TPIA GE + + + Q I ++D Sbjct: 210 LRAFKLFEPLNLLWIEEPMPSDDIAGHLRLRERSATPIALGENVYNLNQFTQYIESGSAD 269 Query: 297 FVQPDAPRVGGISPFLKIMDLAAKHGRKLAPHFAMEVHLHLSAAYPLEPWLEHFE---WL 353 ++Q D RVGGI+ +L I +A H + PHF ME+ L A P + E + W Sbjct: 270 YIQADLGRVGGITGYLDIAAVARAHNLPMTPHFVMELSASLLATVPNISYAEMTDGGRWK 329 Query: 354 N-PLFNEQLELRDGRMWISDRHGLGFTL 380 + + E E DG S+R G G L Sbjct: 330 DLRIIAEAGEEVDGYYVPSERPGHGIIL 357 Lambda K H 0.319 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 398 Length of database: 367 Length adjustment: 30 Effective length of query: 368 Effective length of database: 337 Effective search space: 124016 Effective search space used: 124016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory